LOCUS       X15855                  1810 bp    DNA     linear   PLN 14-NOV-2006
DEFINITION  Tomato anther specific LAT52 gene.
ACCESSION   X15855
VERSION     X15855.1
KEYWORDS    glycoprotein; LAT52 gene.
SOURCE      Solanum lycopersicum (tomato)
  ORGANISM  Solanum lycopersicum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum; Lycopersicon.
REFERENCE   1  (bases 1 to 1810)
  AUTHORS   Twell D., Wing R., Yamaguchi J., McCormick S.
  TITLE     Isolation and expression of an anther-specific gene from tomato
  JOURNAL   Mol. Gen. Genet. 217(2-3), 240-245(1989).
   PUBMED   2770694
COMMENT     Author reports intron to be composed almost entirely of a directly
            repeated sequence of 46 nucleotides.
            
            Data kindly reviewed (07-NOV-1989) by McCormick S.
FEATURES             Location/Qualifiers
     source          1..1810
                     /organism="Solanum lycopersicum"
                     /mol_type="genomic DNA"
                     /clone_lib="lambda gt10"
                     /clone="pLAT52"
                     /db_xref="taxon:4081"
     repeat_region   39..48
                     /note="direct repeat 1"
     repeat_region   119..126
                     /note="direct repeat 2"
     repeat_region   306..315
                     /note="direct repeat 1"
     repeat_region   418..423
                     /note="direct repeat 3"
     repeat_region   461..468
                     /note="direct repeat 2"
     repeat_region   514..519
                     /note="direct repeat 3"
     regulatory      529..532
                     /regulatory_class="TATA_box"
     regulatory      548..551
                     /regulatory_class="TATA_box"
     precursor_RNA   557..1782
                     /note="altern. major transcript"
     precursor_RNA   557..1757
                     /note="major transcript"
     CDS             join(667..820,1279..1610)
                     /gene="LAT52"
                     /db_xref="GOA:P13447"
                     /db_xref="InterPro:IPR006040"
                     /db_xref="InterPro:IPR006041"
                     /db_xref="UniProtKB/Swiss-Prot:P13447"
                     /protein_id="CAA33854.1"
                     /translation="MAKAIVLLSALCILALANFAHCRPEVFDVEGKVYCDTCRVQFET
                     KLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSP
                     REDCKESVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLE
                     F"
     exon            667..820
                     /number=1
     intron          821..1278
                     /number=1
     exon            1279..1757
                     /number=2
     regulatory      1645..1650
                     /regulatory_class="polyA_signal_sequence"
     regulatory      1680..1685
                     /regulatory_class="polyA_signal_sequence"
     polyA_site      1757..1757
     polyA_site      1782..1782
BASE COUNT          581 a          305 c          268 g          656 t
ORIGIN      
        1 cctatacccc ttggataagg gtagctctat ctatatagtc aattattgtc ttctgtctgt
       61 tggtgtcgac atactcgact cagaaggtat tgaggaatga tcgattctgg gtcatttgtg
      121 tggttaatca ccctccaaat caactaagtc atcctgaagg acaatatcct attttttctc
      181 tcgtaggttt atcatttaaa ttactatcgc gtgataattt tgtaacgtag aaaaataata
      241 ccattaatcc aaacgttata ttcattaaaa taattatgat acatttaaaa atatttcgtg
      301 acctctcaat tattgcaaat tctaagccat cccaagtttt gaggctaatt ttttttacta
      361 tactattttt acaaccacaa aaacataaaa aataaaaaat aaaaaaaata aaccgagtca
      421 attgctacaa tcacttcatt attaatttta attaatatta tgtggttata tatgaaactg
      481 ttagagaaat aatagctcca ccatattttt ttctcaattt attttcacta taaaaaggct
      541 atttcattat aatcaaaaca agacacacac aaagagaagg agcaataaaa taaaagtaaa
      601 caacaatttg tgtgtttaaa aaaaaaaaaa aagtacacac accaaaaaaa aaaattccaa
      661 tttaaaatgg caaaggctat tgtgctcctc tctgctcttt gcattttggc ccttgccaat
      721 tttgcacatt gccgccctga agtttttgat gttgaaggaa aggtctactg tgatacttgc
      781 cgcgttcaat tcgaaacaaa actcagcgag aaccttgaag gtatatacta tattttcatt
      841 cacttcgttc tatcagactc atttcatctt atatatattt acattcactt tgttctattc
      901 aggctcattt catcttatat aaatttacat tcacttcgtt ctattcaggc tcatttcatc
      961 ttatgtatat ttacattcac ttagttctat tcaggctcat ttcatcttat atatatttac
     1021 attcacttcg ttctattcag actcatttca tcttatatat atttacattc actttgtttt
     1081 attcagactc atttcatctt atataaattt acattcactt cgttctattc aggctcattt
     1141 catcttatgt atatttacat tcacttcgtt ctattcagac tcatttcatc ttatatatat
     1201 atacattcac tttgttctat tcagactcat ttcatctaat aactccgtat tgattatgtt
     1261 ttgttttgtt gcaaataggt gcaactgtga agttgcaatg caggaacatc agcacagagg
     1321 ctgagacgtt ttcagtggaa ggtgtgactg ataaagatgg caagtacaaa ttaaccgtta
     1381 atggagacca cgagaacgat atttgcgagg tgacagttgt gaaaagccca agggaggact
     1441 gcaaagagag tgtgtctgga tatgaaaagg caagaattga gtgtagtgac aatgttggta
     1501 tccacaatgc tgtgagattt gccaatccac ttttcttcat gaaggctgag tctgttcaag
     1561 gatgcaaaga agctcttgat gagttgggtt tattccccct tgaattctaa aaaagtcttt
     1621 ttcttttttt ttaacgtgac agaaaataaa ttagtccttt tcatgttgta atgcgaaata
     1681 ataaaaatat gaggaaaaga tggatttctc atttatatgt attcatatgg gatgataagt
     1741 tccatgtatt tgtttttaat gagaagatct tgatcatatt taagaaacta tgttctcttc
     1801 ttggtgtttg
//