LOCUS X15545 474 bp DNA linear BCT 23-JUN-1996 DEFINITION Bacillus amyloliquefaciens barstar gene. ACCESSION X15545 VERSION X15545.1 KEYWORDS barstar; ribonuclease inhibitor. SOURCE Bacillus amyloliquefaciens ORGANISM Bacillus amyloliquefaciens Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus amyloliquefaciens group. REFERENCE 1 (bases 1 to 436) AUTHORS Hartley R.W. TITLE Barnase and barstar. Expression of its cloned inhibitor permits expression of a cloned ribonuclease JOURNAL J. Mol. Biol. 202(4), 913-915(1988). PUBMED 3050134 REFERENCE 2 (bases 1 to 474) AUTHORS Hartley R. JOURNAL Submitted (14-JAN-1996) to the INSDC. R.Hartley, LCDB/NIDDK, NIH, Bethesda, 20892 USA, email:hartleyr@helix.nih.gov REMARK Revised by author COMMENT See also acc# x12871. FEATURES Location/Qualifiers source 1..474 /organism="Bacillus amyloliquefaciens" /mol_type="genomic DNA" /clone="pMT311" /db_xref="taxon:1390" regulatory 94..99 /note="-10 region" /regulatory_class="promoter" regulatory 109..119 /note="pot. ribosome binding site" /regulatory_class="ribosome_binding_site" CDS 124..396 /transl_table=11 /note="barstar (AA 1 - 90)" /db_xref="GOA:P11540" /db_xref="InterPro:IPR000468" /db_xref="InterPro:IPR035905" /db_xref="PDB:1A19" /db_xref="PDB:1AB7" /db_xref="PDB:1AY7" /db_xref="PDB:1B27" /db_xref="PDB:1B2S" /db_xref="PDB:1B2U" /db_xref="PDB:1B3S" /db_xref="PDB:1BGS" /db_xref="PDB:1BRS" /db_xref="PDB:1BTA" /db_xref="PDB:1BTB" /db_xref="PDB:1L1K" /db_xref="PDB:1X1U" /db_xref="PDB:1X1W" /db_xref="PDB:1X1X" /db_xref="PDB:1X1Y" /db_xref="PDB:2HXX" /db_xref="PDB:2ZA4" /db_xref="PDB:3DA7" /db_xref="UniProtKB/Swiss-Prot:P11540" /protein_id="CAA33551.1" /translation="MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTG WVEYPLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGCDITIILS" BASE COUNT 154 a 104 c 123 g 93 t ORIGIN 1 gtccaatctg cagccgtccg agacaggagg acatcgtcca gctgaaaccg gggcagaatc 61 cggccatttc tgaagagaaa aatggtaaac tgatagaata aaatcataag aaaggagccg 121 cacatgaaaa aagcagtcat taacggggaa caaatcagaa gtatcagcga cctccaccag 181 acattgaaaa aggagcttgc ccttccggaa tactacggtg aaaacctgga cgctttatgg 241 gattgtctga ccggatgggt ggagtacccg ctcgttttgg aatggaggca gtttgaacaa 301 agcaagcagc tgactgaaaa tggcgccgag agtgtgcttc aggttttccg tgaagcgaaa 361 gcggaaggct gcgacatcac catcatactt tcttaatacg atcaatggga gatgaacaat 421 atggaaacac aaaccctcag ctatccgatt ggagaatatc agccgcctga atcg //