LOCUS       X15545                   474 bp    DNA     linear   BCT 23-JUN-1996
DEFINITION  Bacillus amyloliquefaciens barstar gene.
ACCESSION   X15545
VERSION     X15545.1
KEYWORDS    barstar; ribonuclease inhibitor.
SOURCE      Bacillus amyloliquefaciens
  ORGANISM  Bacillus amyloliquefaciens
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
            Bacillus amyloliquefaciens group.
REFERENCE   1  (bases 1 to 436)
  AUTHORS   Hartley R.W.
  TITLE     Barnase and barstar. Expression of its cloned inhibitor permits
            expression of a cloned ribonuclease
  JOURNAL   J. Mol. Biol. 202(4), 913-915(1988).
   PUBMED   3050134
REFERENCE   2  (bases 1 to 474)
  AUTHORS   Hartley R.
  JOURNAL   Submitted (14-JAN-1996) to the INSDC. R.Hartley, LCDB/NIDDK, NIH,
            Bethesda, 20892 USA, email:hartleyr@helix.nih.gov
  REMARK    Revised by author
COMMENT     See also acc# x12871.
FEATURES             Location/Qualifiers
     source          1..474
                     /organism="Bacillus amyloliquefaciens"
                     /mol_type="genomic DNA"
                     /clone="pMT311"
                     /db_xref="taxon:1390"
     regulatory      94..99
                     /note="-10 region"
                     /regulatory_class="promoter"
     regulatory      109..119
                     /note="pot. ribosome binding site"
                     /regulatory_class="ribosome_binding_site"
     CDS             124..396
                     /transl_table=11
                     /note="barstar (AA 1 - 90)"
                     /db_xref="GOA:P11540"
                     /db_xref="InterPro:IPR000468"
                     /db_xref="InterPro:IPR035905"
                     /db_xref="PDB:1A19"
                     /db_xref="PDB:1AB7"
                     /db_xref="PDB:1AY7"
                     /db_xref="PDB:1B27"
                     /db_xref="PDB:1B2S"
                     /db_xref="PDB:1B2U"
                     /db_xref="PDB:1B3S"
                     /db_xref="PDB:1BGS"
                     /db_xref="PDB:1BRS"
                     /db_xref="PDB:1BTA"
                     /db_xref="PDB:1BTB"
                     /db_xref="PDB:1L1K"
                     /db_xref="PDB:1X1U"
                     /db_xref="PDB:1X1W"
                     /db_xref="PDB:1X1X"
                     /db_xref="PDB:1X1Y"
                     /db_xref="PDB:2HXX"
                     /db_xref="PDB:2ZA4"
                     /db_xref="PDB:3DA7"
                     /db_xref="UniProtKB/Swiss-Prot:P11540"
                     /protein_id="CAA33551.1"
                     /translation="MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLTG
                     WVEYPLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGCDITIILS"
BASE COUNT          154 a          104 c          123 g           93 t
ORIGIN      
        1 gtccaatctg cagccgtccg agacaggagg acatcgtcca gctgaaaccg gggcagaatc
       61 cggccatttc tgaagagaaa aatggtaaac tgatagaata aaatcataag aaaggagccg
      121 cacatgaaaa aagcagtcat taacggggaa caaatcagaa gtatcagcga cctccaccag
      181 acattgaaaa aggagcttgc ccttccggaa tactacggtg aaaacctgga cgctttatgg
      241 gattgtctga ccggatgggt ggagtacccg ctcgttttgg aatggaggca gtttgaacaa
      301 agcaagcagc tgactgaaaa tggcgccgag agtgtgcttc aggttttccg tgaagcgaaa
      361 gcggaaggct gcgacatcac catcatactt tcttaatacg atcaatggga gatgaacaat
      421 atggaaacac aaaccctcag ctatccgatt ggagaatatc agccgcctga atcg
//