LOCUS       X15218                  3511 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human ski oncogene mRNA.
ACCESSION   X15218
VERSION     X15218.1
KEYWORDS    oncogene; ski oncogene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3511)
  AUTHORS   Nomura,N.
  JOURNAL   Submitted (08-MAY-1989) to the INSDC. Nomura N., Molecular Oncology
            Laboratory, Nippon Medical School, Sakuragi , 1-10-19 Uenosakuragi 
              Taito-ku, Tokyo 110, JAPAN.
REFERENCE   2  (bases 1 to 3511)
  AUTHORS   Nomura,N., Sasamoto,S., Ishii,S., Matsui,M. and  Ishizaki,R.
  TITLE     Isolation of human cDNA clones of ski and the ski-related gene, sno
  JOURNAL   Nucleic Acids Res. 17(14), 5489-5500(1989).
   PUBMED   2762147
COMMENT     see x15217 and x15219 for ski-related mRNAs, snoA and snoN.
FEATURES             Location/Qualifiers
     source          1..3511
                     /db_xref="H-InvDB:HIT000321493"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_type="endothelial cells."
                     /tissue_type="umbilicord vein"
                     /db_xref="taxon:9606"
     CDS             73..2259
                     /note="ski protein (AA 1 - 728)"
                     /db_xref="GOA:P12755"
                     /db_xref="H-InvDB:HIT000321493.15"
                     /db_xref="HGNC:HGNC:10896"
                     /db_xref="InterPro:IPR003380"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR010919"
                     /db_xref="InterPro:IPR014890"
                     /db_xref="InterPro:IPR023216"
                     /db_xref="PDB:1MR1"
                     /db_xref="PDB:1SBX"
                     /db_xref="UniProtKB/Swiss-Prot:P12755"
                     /protein_id="CAA33288.1"
                     /translation="MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQ
                     EAYKKESAKEAGAAAVPAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCE
                     TVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEI
                     LKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSV
                     RVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGF
                     DSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRP
                     KTDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPAVSASEKE
                     LSPHLPALIRDSFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCT
                     QPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSS
                     SAKDLGSPGARALPSAVPDAAAPADAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEV
                     VKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENE
                     KKMKEANESRLRLKRELEQARQARVCDKGCEAGRLRAKYSAQIEDLQVKLQHAEADRE
                     QLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGSEGAAELEP"
     variation       3369..3369
                     /note="a is g in variant clone"
     misc_feature    3373..3373
                     /note="3' end of variant clone with 7 additional A
                     residues"
     misc_feature    3503..3508
                     /note="put. polyA signal"
BASE COUNT          663 a         1159 c         1089 g          600 t
ORIGIN
        1 cggggcggcg gcgggggccg ggggggcccg ggcgcgcggg agcgggagcg gccgggggag
       61 ccggagcgca ccatggaggc ggcggcaggc ggccgcggct gtttccagcc gcacccgggg
      121 ctgcagaaga cgctggagca gttccacctg agctccatga gctcgctggg cggcccggcc
      181 gctttctcgg cgcgctgggc gcaggaggcc tacaagaagg agagcgccaa ggaggcgggc
      241 gcggccgcgg tgccggcgcc ggtgcccgca gccaccgagc cgccgcccgt gctgcacctg
      301 cccgccatcc agccgccgcc gcccgtgctg cccgggccct tcttcatgcc gtccgaccgc
      361 tccaccgagc gctgcgagac cgtactggaa ggcgagacca tctcgtgctt cgtggtggga
      421 ggcgagaagc gcctgtgtct gccgcagatt ctcaactcgg tgctgcgcga cttctcgctg
      481 cagcagatca acgcggtgtg cgacgagctc cacatctact gctcgcgctg cacggccgac
      541 cagctggaga tcctcaaagt catgggcatc ctgcccttct cggcgccctc gtgcgggctc
      601 atcaccaaga cggacgccga gcgcctgtgc aacgcgctgc tctacggcgg cgcctacccg
      661 ccgccctgca agaaggagct ggccgccagc ctggcgctgg gcctggagct cagcgagcgc
      721 agcgtccgcg tgtaccacga gtgcttcggc aagtgtaagg ggctgctggt gcccgagctc
      781 tacagcagcc cgagcgccgc ctgcatccag tgcctggact gccgcctcat gtacccgccg
      841 cacaagttcg tggtgcactc gcacaaggcc ctggagaacc ggacctgcca ctggggcttc
      901 gactcggcca actggcgggc ctacatcctg ctgagccagg attacacggg caaggaggag
      961 caggcgcgcc tcggccgctg cctggacgac gtgaaggaga aattcgacta tggcaacaag
     1021 tacaagcggc gggtgccccg ggtctcctct gagcctccgg cctccataag acccaaaaca
     1081 gatgacacct cttcccagtc ccccgcgcct tccgaaaagg acaagccgtc cagctggctg
     1141 cggaccttgg ccggctcttc caataagagc ctgggctgtg ttcaccctcg ccagcgcctc
     1201 tctgctttcc gaccctggtc ccccgcagtg tcagcgagtg agaaagagct ctccccacac
     1261 ctcccggccc tcatccgaga cagcttctac tcctacaaga gctttgagac agccgtggcg
     1321 cccaacgtgg ccctcgcacc gccggcccag cagaaggttg tgagcagccc tccgtgtgcc
     1381 gccgccgtct cccgggcccc cgagcctctc gccacttgca cccagcctcg gaagcggaag
     1441 ctgactgtgg acaccccagg agccccagag acgctggcgc ccgtggctgc cccagaggag
     1501 gacaaggact cggaggcgga ggtggaagtt gaaagcaggg aggaattcac ctcctccttg
     1561 tcctcgctct cttccccgtc ctttacctca tccagctccg ccaaggacct gggctccccg
     1621 ggtgcgcgtg ccctgccctc ggccgtccct gatgctgcgg cccctgccga cgcccccagt
     1681 gggctggagg cggagctgga gcacctgcgg caggcactgg agggcggcct ggacaccaag
     1741 gaagccaaag agaagttcct gcatgaggtg gtcaagatgc gcgtgaagca ggaggagaag
     1801 ctcagcgcag ccctgcaggc caagcgcagc ctccaccagg agctggagtt cctacgcgtg
     1861 gccaagaagg agaagctgcg ggaggccacg gaggccaagc gtaacctgcg gaaggagatc
     1921 gagcgtctcc gcgccgagaa cgagaagaag atgaaagagg ccaacgagtc acggctgcgc
     1981 ctgaagcggg agctggagca ggcgcggcag gcccgggtgt gcgacaaggg ctgcgaggcg
     2041 ggccgcctgc gcgccaagta ctcggcccag atcgaagacc tgcaggtgaa gctgcagcac
     2101 gcggaggcgg accgggagca gctgcgggcc gacctgctgc gggagcgcga ggcccgggag
     2161 cacctggaga aggtggtgaa ggagctgcag gaacagctgt ggccgcgggc ccgccccgag
     2221 gctgcgggca gcgagggcgc tgcggagctg gagccgtaga ttccgtgcct gccgccgcag
     2281 cgccgccgac aacgcgggtg caggggggcg cggctgggcg gtgcagctcc gcccggctcc
     2341 gcccctgcag cccacacagc acaacgtctt accgtgccta ttaccaagcg agtgtttgta
     2401 accatgtagt tttggaaccc actgcaaaat tttctactgg ccaagttcaa gtgagtaagc
     2461 cgcgtccccc aactacagct ggagacgggg ccagctcggc ggcctgctgg tcctctgctt
     2521 gctggaacat tctaacattt acacttttgt tataagctat ttaaaaccag taaggagact
     2581 tgaaattcag aaaatcaaca catttttaaa tgactaactt ctaaaagccc caacacatga
     2641 cgccatctga agacccgcaa cggagtgggg gtggcggccg ccccaccctc cccacccggg
     2701 gaagccatca cagctcatct gcccgcggct gcgtgaggac agcaggggtt tttcttcaga
     2761 gtctattttt tcagcgacaa ggacccaggt cttcctgctg ctgccaggga gagcagggac
     2821 agtgccgcgt gcgagatgag ctcgaacact gcccgcctta ctgccgccta ccccgcccgc
     2881 cacgccgccg tcgatgccag cgctgtcccc acgggtacca ggaagtgcag agccgcacag
     2941 gagctgcccc ggagctgagg ggacggtctt cggctcctct gcaccccgtg attctgccca
     3001 cgctcctcca ccacgaggca ctgacctgcg tcgggtggtg accgtggctg gcggtcacgc
     3061 cctcagccct ccgggcacac gtgccgcctg accgggcgac ccttttcagt tcggcaaacg
     3121 tcgctccctt cattttggga ctgaggctgc agcattggaa caaaagagca ttatttcaat
     3181 ttttctttct ttttttttgt tcgttcattt aaacgtatat ttagaactgc actttgtcca
     3241 caaccttccc ttctctttct attccccagt gaactgaggt ttttaccgac tttatagagc
     3301 agtcaaatcc gaagtgctcg agtgcttaga aaccccctct ggtgcttggt tgaacaaggg
     3361 aatcacaaaa aaacgaaaat gcaaaaactg aacttcgggg gtcgttctgt gccttccagc
     3421 atcttgtaca gcaaatcctg actcgtgtct ttttaccccc aagatatctg tcttcagtag
     3481 cgactgaatc tgccactctc agaataagtt c
//