LOCUS       X13916                 14896 bp    mRNA    linear   HUM 18-APR-1996
DEFINITION  Human mRNA for LDL-receptor related protein.
ACCESSION   X13916
VERSION     X13916.1
KEYWORDS    calcium binding protein; cell surface protein; lipoprotein
            receptor; low density lipoprotein receptor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 14896)
  AUTHORS   Herz J.J.
  JOURNAL   Submitted (24-NOV-1988) to the INSDC. Herz J.J., EMBL,
            Meyerhofstrasse 1, 6900 Heidelberg, FRG.
REFERENCE   2
  AUTHORS   Herz J.J., Hamann U., Rogne S., Myklebost O., Gausepohl H.,
            Stanley K.K.
  TITLE     Surface location and high affinity for calcium of a 500-kd liver
            membrane protein closely related to the LDL-receptor suggest a
            physiological role as lipoprotein receptor
  JOURNAL   EMBO J. 7(13), 4119-4127(1988).
   PUBMED   3266596
REFERENCE   3
  AUTHORS   Myklebost O., Arheden K., Rogne S., Van Kessel G., Mandahl N.,
            Herz J., Stanley K., Heim S., Mitelman F.
  TITLE     The gene for the human putative apoE receptor is on chromosome 12
            in the segment q13-14
  JOURNAL   Genomics 5(1), 65-69(1989).
   PUBMED   2548950
COMMENT     Data kindly reviewed (16-MAY-1989) by Herz J. J.
FEATURES             Location/Qualifiers
     source          1..14896
                     /db_xref="H-InvDB:HIT000321395"
                     /organism="Homo sapiens"
                     /map="chromosome 12 q13-14"
                     /mol_type="mRNA"
                     /clone_lib="HL9"
                     /clone="LRP 1-9"
                     /tissue_type="liver"
                     /db_xref="taxon:9606"
     CDS             467..14101
                     /product="LDL-receptor related precursor (AA -19 to 4525)"
                     /db_xref="GOA:Q07954"
                     /db_xref="H-InvDB:HIT000321395.14"
                     /db_xref="HGNC:HGNC:6692"
                     /db_xref="InterPro:IPR000033"
                     /db_xref="InterPro:IPR000152"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR001881"
                     /db_xref="InterPro:IPR002172"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR018097"
                     /db_xref="InterPro:IPR023415"
                     /db_xref="InterPro:IPR026823"
                     /db_xref="InterPro:IPR032485"
                     /db_xref="PDB:1CR8"
                     /db_xref="PDB:1D2L"
                     /db_xref="PDB:1J8E"
                     /db_xref="PDB:2FYJ"
                     /db_xref="PDB:2FYL"
                     /db_xref="PDB:2KNX"
                     /db_xref="PDB:2KNY"
                     /db_xref="UniProtKB/Swiss-Prot:Q07954"
                     /protein_id="CAA32112.1"
                     /translation="MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKG
                     WRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGS
                     DEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTC
                     SQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQ
                     VSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINIS
                     LSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAM
                     GKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIE
                     VVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNSDNANAQQKTSVIRVNRFNSTEY
                     QVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCSDICLLANSHKARTCRCRS
                     GFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRALDF
                     HAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGPK
                     KTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERA
                     WMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGP
                     ELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVTLLRSERPPIFEIRMYDAQ
                     QQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGVTCLANPSYVPPPQCQP
                     GEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPNRWLC
                     DGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCA
                     YPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPE
                     HWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDC
                     MDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENCESLACR
                     PPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPGEGI
                     VCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCR
                     SLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
                     IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLR
                     TTLLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWP
                     NGLTVDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWT
                     DWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGQGPCSHL
                     CLINYNRTVSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFT
                     VPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWV
                     SRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISM
                     ANMDGSNRTLLFSGQKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRS
                     QLGKATALAIMGDKLWWADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQL
                     DHKGTNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEG
                     IRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWRED
                     VVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVH
                     PEKGYLFWTEWGQYPRIERSRLDGTERVVLVNVSISWPNGISVDYQDGKLYWCDARTD
                     KIERIDLETGENREVVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRGSKDNATDSV
                     PLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQLCLYRGRGQRACACAHGMLAED
                     GASCREYAGYLLYSERTILKSIHLSDERNLNAPVQPFEDPEHMKNVIALAFDYRAGTS
                     PGTPNRIFFSDIHFGNIQQINDDGSRRITIVENVGSVEGLAYHRGWDTLYWTSYTTST
                     ITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALS
                     GANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVILKSEPVHP
                     FGLAVYGEHIFWTDWVRRAVQRANKHVGSNMKLLRVDIPQQPMGIIAVANDTNSCELS
                     PCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAVNSSCRAQDEFECANGECI
                     NFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVSNMLWCNGADDCGDGSD
                     EIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKG
                     VLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMS
                     WTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAAHCE
                     GKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDDREFMCQNR
                     QCIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDGENDCHD
                     QSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGCHINEC
                     LSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTHGS
                     YKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAV
                     ALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYW
                     CDKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMD
                     GSSRSVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHI
                     FALTLFEDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNH
                     PCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFW
                     WKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANC
                     DIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRC
                     IPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGS
                     DEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSC
                     ANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMD
                     GSDEEACGTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPN
                     RPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAHTTHCKDKKEFLCRNQRCLS
                     SSLRCNMFDDCGDGSDEEDCSIDPKLTSCATNASICGDEARCVRTEKAAYCACRSGFH
                     TVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEGSEYQVLYI
                     ADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISYRSLP
                     PAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMK
                     GENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQW
                     PTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYG
                     VTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLL
                     SPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTCNLQCFNGGSCFLNARRQPKC
                     RCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGYCAN
                     NSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEG
                     SRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMM
                     PECQCPPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLLVLVAGVVFWYKRRVQGAK
                     GFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATL
                     YMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA"
     sig_peptide     467..523
                     /note="put. signal peptide (-19 to -1)"
     mat_peptide     524..14098
                     /note="LDL-receptor related protein (AA 1-4525)"
     misc_feature    524..790
                     /note="LDL-receptor-like domain 1"
     misc_feature    3026..4012
                     /note="LDL-receptor-like domain 2"
     misc_feature    8036..9283
                     /note="LDL-receptor-like domain 3"
     misc_feature    10466..11794
                     /note="LDL-receptor-like domain 4"
BASE COUNT         3192 a         4562 c         4395 g         2747 t
ORIGIN      
        1 cagcggtgcg agctccaggc ccatgcactg aggaggcgga aacaagggga gcccccagag
       61 ctccatcaag ccccctccaa aggctcccct acccggtcca cgccccccac cccccctccc
      121 cgcctcctcc caattgtgca tttttgcagc cggaggcggc tccgagatgg ggctgtgagc
      181 ttcgcccggg gagggggaaa gagcagcgag gagtgaagcg ggggggtggg gtgaagggtt
      241 tggatttcgg ggcagggggc gcacccccgt cagcaggccc tccccaaggg gctcggaact
      301 ctacctcttc acccacgccc ctggtgcgct ttgccgaagg aaagaataag aacagagaag
      361 gaggaggggg aaaggaggaa aagggggacc ccccaactgg ggggggtgaa ggagagaagt
      421 agcaggacca gaggggaagg ggctgctgct tgcatcagcc cacaccatgc tgaccccgcc
      481 gttgctcctg ctgctgcccc tgctctcagc tctggtcgcg gcggctatcg acgcccctaa
      541 gacttgcagc cccaagcagt ttgcctgcag agatcaaata acctgtatct caaagggctg
      601 gcggtgcgac ggtgagaggg actgcccaga cggatctgac gaggcccctg agatttgtcc
      661 acagagtaag gcccagcgat gccagccaaa cgagcataac tgcctgggta ctgagctgtg
      721 tgttcccatg tcccgcctct gcaatggggt ccaggactgc atggacggct cagatgaggg
      781 gccccactgc cgagagctcc aaggcaactg ctctcgcctg ggctgccagc accattgtgt
      841 ccccacactc gatgggccca cctgctactg caacagcagc tttcagcttc aggcagatgg
      901 caagacctgc aaagattttg atgagtgctc agtgtacggc acctgcagcc agctatgcac
      961 caacacagac ggctccttca tatgtggctg tgttgaagga tacctcctgc agccggataa
     1021 ccgctcctgc aaggccaaga acgagccagt agaccggccc cctgtgctgt tgatagccaa
     1081 ctcccagaac atcttggcca cgtacctgag tggggcccag gtgtctacca tcacacctac
     1141 gagcacgcgg cagaccacag ccatggactt cagctatgcc aacgagaccg tatgctgggt
     1201 gcatgttggg gacagtgctg ctcagacgca gctcaagtgt gcccgcatgc ctggcctaaa
     1261 gggcttcgtg gatgagcaca ccatcaacat ctccctcagt ctgcaccacg tggaacagat
     1321 ggccatcgac tggctgacag gcaacttcta ctttgtggat gacatcgatg ataggatctt
     1381 tgtctgcaac agaaatgggg acacatgtgt cacattgcta gacctggaac tctacaaccc
     1441 caagggcatt gccctggacc ctgccatggg gaaggtgttt ttcactgact atgggcagat
     1501 cccaaaggtg gaacgctgtg acatggatgg gcagaaccgc accaagctcg tcgacagcaa
     1561 gattgtgttt cctcatggca tcacgctgga cctggtcagc cgccttgtct actgggcaga
     1621 tgcctatctg gactatattg aagtggtgga ctatgagggc aagggccgcc agaccatcat
     1681 ccagggcatc ctgattgagc acctgtacgg cctgactgtg tttgagaatt atctctatgc
     1741 caccaactcg gacaatgcca atgcccagca gaagacgagt gtgatccgtg tgaaccgctt
     1801 taacagcacc gagtaccagg ttgtcacccg ggtggacaag ggtggtgccc tccacatcta
     1861 ccaccagagg cgtcagcccc gagtgaggag ccatgcctgt gaaaacgacc agtatgggaa
     1921 gccgggtggc tgctctgaca tctgcctgct ggccaacagc cacaaggcgc ggacctgccg
     1981 ctgccgttcc ggcttcagcc tgggcagtga cgggaagtca tgcaagaagc cggagcatga
     2041 gctgttcctc gtgtatggca agggccggcc aggcatcatc cggggcatgg atatgggggc
     2101 caaggtcccg gatgagcaca tgatccccat tgaaaacctc atgaaccccc gagccctgga
     2161 cttccacgct gagaccggct tcatctactt tgccgacacc accagctacc tcattggccg
     2221 ccagaagatt gatggcactg agcgggagac catcctgaag gacggcatcc acaatgtgga
     2281 gggtgtggcc gtggactgga tgggagacaa tctgtactgg acggacgatg ggcccaaaaa
     2341 gacaatcagc gtggccaggc tggagaaagc tgctcagacc cgcaagactt taatcgaggg
     2401 caaaatgaca caccccaggg ctattgtggt ggatccactc aatgggtgga tgtactggac
     2461 agactgggag gaggacccca aggacagtcg gcgtgggcgg ctggagaggg cgtggatgga
     2521 tggctcacac cgagacatct ttgtcacctc caagacagtg ctttggccca atgggctaag
     2581 cctggacatc ccggctgggc gcctctactg ggtggatgcc ttctacgacc gcatcgagac
     2641 gatactgctc aatggcacag accggaagat tgtgtatgaa ggtcctgagc tgaaccacgc
     2701 ctttggcctg tgtcaccatg gcaactacct cttctggact gagtatcgga gtggcagtgt
     2761 ctaccgcttg gaacggggtg taggaggcgc accccccact gtgacccttc tgcgcagtga
     2821 gcggcccccc atctttgaga tccgaatgta tgatgcccag cagcagcaag ttggcaccaa
     2881 caaatgccgg gtgaacaatg gcggctgcag cagcctgtgc ttggccaccc ctgggagccg
     2941 ccagtgcgcc tgtgctgagg accaggtgtt ggacgcagac ggcgtcactt gcttggcgaa
     3001 cccatcctac gtgcctccac cccagtgcca gccaggcgag tttgcctgtg ccaacagccg
     3061 ctgcatccag gagcgctgga agtgtgacgg agacaacgat tgcctggaca acagtgatga
     3121 ggccccagcc ctctgccatc agcacacctg cccctcggac cgattcaagt gcgagaacaa
     3181 ccggtgcatc cccaaccgct ggctctgcga cggggacaat gactgtggga acagtgaaga
     3241 tgagtccaat gccacttgtt cagcccgcac ctgccccccc aaccagttct cctgtgccag
     3301 tggccgctgc atccccatct cctggacgtg tgatctggat gacgactgtg gggaccgctc
     3361 tgatgagtct gcttcgtgtg cctatcccac ctgcttcccc ctgactcagt ttacctgcaa
     3421 caatggcaga tgtatcaaca tcaactggag atgcgacaat gacaatgact gtggggacaa
     3481 cagtgacgaa gccggctgca gccactcctg ttctagcacc cagttcaagt gcaacagcgg
     3541 gcgttgcatc cccgagcact ggacctgcga tggggacaat gactgcggag actacagtga
     3601 tgagacacac gccaactgca ccaaccaggc cacgaggccc cctggtggct gccacactga
     3661 tgagttccag tgccggctgg atggactatg catccccctg cggtggcgct gcgatgggga
     3721 cactgactgc atggactcca gcgatgagaa gagctgtgag ggagtgaccc acgtctgcga
     3781 tcccagtgtc aagtttggct gcaaggactc agctcggtgc atcagcaaag cgtgggtgtg
     3841 tgatggcgac aatgactgtg aggataactc ggacgaggag aactgcgagt ccctggcctg
     3901 caggccaccc tcgcaccctt gtgccaacaa cacctcagtc tgcctgcccc ctgacaagct
     3961 gtgtgatggc aacgacgact gtggcgacgg ctcagatgag ggcgagctct gcgaccagtg
     4021 ctctctgaat aacggtggct gcagccacaa ctgctcagtg gcacctggcg aaggcattgt
     4081 gtgttcctgc cctctgggca tggagctggg gcccgacaac cacacctgcc agatccagag
     4141 ctactgtgcc aagcatctca aatgcagcca aaagtgcgac cagaacaagt tcagcgtgaa
     4201 gtgctcctgc tacgagggct gggtcctgga acctgacggc gagagctgcc gcagcctgga
     4261 ccccttcaag ccgttcatca ttttctccaa ccgccatgaa atccggcgca tcgatcttca
     4321 caaaggagac tacagcgtcc tggtgcccgg cctgcgcaac accatcgccc tggacttcca
     4381 cctcagccag agcgccctct actggaccga cgtggtggag gacaagatct accgcgggaa
     4441 gctgctggac aacggagccc tgactagttt cgaggtggtg attcagtatg gcctggccac
     4501 acccgagggc ctggctgtag actggattgc aggcaacatc tactgggtgg agagtaacct
     4561 ggatcagatc gaggtggcca agctggatgg gaccctccgg accaccctgc tggccggtga
     4621 cattgagcac ccaagggcaa tcgcactgga tccccgggat gggatcctgt tttggacaga
     4681 ctgggatgcc agcctgcccc gcattgaggc agcctccatg agtggggctg ggcgccgcac
     4741 cgtgcaccgg gagaccggct ctgggggctg gcccaacggg ctcaccgtgg actacctgga
     4801 gaagcgcatc ctttggattg acgccaggtc agatgccatt tactcagccc gttacgacgg
     4861 ctctggccac atggaggtgc ttcggggaca cgagttcctg tcgcacccgt ttgcagtgac
     4921 gctgtacggg ggggaggtct actggactga ctggcgaaca aacacactgg ctaaggccaa
     4981 caagtggacc ggccacaatg tcaccgtggt acagaggacc aacacccagc cctttgacct
     5041 gcaggtgtac cacccctccc gccagcccat ggctcccaat ccctgtgagg ccaatggggg
     5101 ccagggcccc tgctcccacc tgtgtctcat caactacaac cggaccgtgt cctgcgcctg
     5161 cccccacctc atgaagctcc acaaggacaa caccacctgc tatgagttta agaagttcct
     5221 gctgtacgca cgtcagatgg agatccgagg tgtggacctg gatgctccct actacaacta
     5281 catcatctcc ttcacggtgc ccgacatcga caacgtcaca gtgctagact acgatgcccg
     5341 cgagcagcgt gtgtactggt ctgacgtgcg gacacaggcc atcaagcggg ccttcatcaa
     5401 cggcacaggc gtggagacag tcgtctctgc agacttgcca aatgcccacg ggctggctgt
     5461 ggactgggtc tcccgaaacc tgttctggac aagctatgac accaataaga agcagatcaa
     5521 tgtggcccgg ctggatggct ccttcaagaa cgcagtggtg cagggcctgg agcagcccca
     5581 tggccttgtc gtccaccctc tgcgtgggaa gctctactgg accgatggtg acaacatcag
     5641 catggccaac atggatggca gcaatcgcac cctgctcttc agtggccaga agggccccgt
     5701 gggcctggct attgacttcc ctgaaagcaa actctactgg atcagctccg ggaaccatac
     5761 catcaaccgc tgcaacctgg atgggagtgg gctggaggtc atcgatgcca tgcggagcca
     5821 gctgggcaag gccaccgccc tggccatcat gggggacaag ctgtggtggg ctgatcaggt
     5881 gtcggaaaag atgggcacat gcagcaaggc tgacggctcg ggctccgtgg tccttcggaa
     5941 cagcaccacc ctggtgatgc acatgaaggt ctatgacgag agcatccagc tggaccataa
     6001 gggcaccaac ccctgcagtg tcaacaacgg tgactgctcc cagctctgcc tgcccacgtc
     6061 agagacgacc cgctcctgca tgtgcacagc cggctatagc ctccggagtg gccagcaggc
     6121 ctgcgagggc gtaggttcct ttctcctgta ctctgtgcat gagggaatca ggggaattcc
     6181 cctggatccc aatgacaagt cagatgccct ggtcccagtg tccgggacct cgctggctgt
     6241 cggcatcgac ttccacgctg aaaatgacac catctactgg gtggacatgg gcctgagcac
     6301 gatcagccgg gccaagcggg accagacgtg gcgtgaagac gtggtgacca atggcattgg
     6361 ccgtgtggag ggcattgcag tggactggat cgcaggcaac atctactgga cagaccaggg
     6421 ctttgatgtc atcgaggtcg cccggctcaa tggctccttc cgctacgtgg tgatctccca
     6481 gggtctagac aagccccggg ccatcaccgt ccacccggag aaagggtact tgttctggac
     6541 tgagtggggt cagtatccgc gtattgagcg gtctcggcta gatggcacgg agcgtgtggt
     6601 gctggtcaac gtcagcatca gctggcccaa cggcatctca gtggactacc aggatgggaa
     6661 gctgtactgg tgcgatgcac ggacagacaa gattgaacgg atcgacctgg agacaggtga
     6721 gaaccgcgag gtggttctgt ccagcaacaa catggacatg ttttcagtgt ctgtgtttga
     6781 ggatttcatc tactggagtg acaggactca tgccaacggc tctatcaagc gcgggagcaa
     6841 agacaatgcc acagactccg tgcccctgcg aaccggcatc ggcgtccagc ttaaagacat
     6901 caaagtcttc aaccgggacc ggcagaaagg caccaacgtg tgcgcggtgg ccaatggcgg
     6961 gtgccagcag ctgtgcctgt accggggccg tgggcagcgg gcctgcgcct gtgcccacgg
     7021 gatgctggct gaagacggag catcgtgccg cgagtatgcc ggctacctgc tctactcaga
     7081 gcgcaccatt ctcaagagta tccacctgtc ggatgagcgc aacctcaatg cgcccgtgca
     7141 gcccttcgag gaccctgagc acatgaagaa cgtcatcgcc ctggcctttg actaccgggc
     7201 aggcacctct ccgggcaccc ccaatcgcat cttcttcagc gacatccact ttgggaacat
     7261 ccaacagatc aacgacgatg gctccaggag gatcaccatt gtggaaaacg tgggctccgt
     7321 ggaaggcctg gcctatcacc gtggctggga cactctctat tggacaagct acacgacatc
     7381 caccatcacg cgccacacag tggaccagac ccgcccaggg gccttcgagc gtgagaccgt
     7441 catcactatg tctggagatg accacccacg ggccttcgtt ttggacgagt gccagaacct
     7501 catgttctgg accaactgga atgagcagca tcccagcatc atgcgggcgg cgctctcggg
     7561 agccaatgtc ctgaccctta tcgagaagga catccgtacc cccaatggcc tggccatcga
     7621 ccaccgtgcc gagaagctct acttctctga cgccaccctg gacaagatcg agcggtgcga
     7681 gtatgacggc tcccaccgct atgtgatcct aaagtcagag cctgtccacc ccttcgggct
     7741 ggccgtgtat ggggagcaca ttttctggac tgactgggtg cggcgggcag tgcagcgggc
     7801 caacaagcac gtgggcagca acatgaagct gctgcgcgtg gacatccccc agcagcccat
     7861 gggcatcatc gccgtggcca acgacaccaa cagctgtgaa ctctctccat gccgaatcaa
     7921 caacggtggc tgccaggacc tgtgtctgct cactcaccag ggccatgtca actgctcatg
     7981 ccgagggggc cgaatcctcc aggatgacct cacctgccga gcggtgaatt cctcttgccg
     8041 agcacaagat gagtttgagt gtgccaatgg cgagtgcatc aacttcagcc tgacctgcga
     8101 cggcgtcccc cactgcaagg acaagtccga tgagaagcca tcctactgca actcccgccg
     8161 ctgcaagaag actttccggc agtgcagcaa tgggcgctgt gtgtccaaca tgctgtggtg
     8221 caacggggcc gacgactgtg gggatggctc tgacgagatc ccttgcaaca agacagcctg
     8281 tggtgtgggc gagttccgct gccgggacgg gacctgcatc gggaactcca gccgctgcaa
     8341 ccagtttgtg gattgtgagg acgcctcaga tgagatgaac tgcagtgcca ccgactgcag
     8401 cagctacttc cgcctgggcg tgaagggcgt gctcttccag ccctgcgagc ggacctcact
     8461 ctgctacgca cccagctggg tgtgtgatgg cgccaatgac tgtggggact acagtgatga
     8521 gcgcgactgc ccaggtgtga aacgccccag atgccctctg aattacttcg cctgccctag
     8581 tgggcgctgc atccccatga gctggacgtg tgacaaagag gatgactgtg aacatggcga
     8641 ggacgagacc cactgcaaca agttctgctc agaggcccag tttgagtgcc agaaccatcg
     8701 ctgcatctcc aagcagtggc tgtgtgacgg cagcgatgac tgtggggatg gctcagacga
     8761 ggctgctcac tgtgaaggca agacgtgcgg cccctcctcc ttctcctgcc ctggcaccca
     8821 cgtgtgcgtc cccgagcgct ggctctgtga cggtgacaaa gactgtgctg atggtgcaga
     8881 cgagagcatc gcagctggtt gcttgtacaa cagcacttgt gacgaccgtg agttcatgtg
     8941 ccagaaccgc cagtgcatcc ccaagcactt cgtgtgtgac cacgaccgtg actgtgcaga
     9001 tggctctgat gagtcccccg agtgtgagta cccgacctgc ggccccagtg agttccgctg
     9061 tgccaatggg cgctgtctga gctcccgcca gtgggagtgt gatggcgaga atgactgcca
     9121 cgaccagagt gacgaggctc ccaagaaccc acactgcacc agcccagagc acaagtgcaa
     9181 tgcctcgtca cagttcctgt gcagcagtgg gcgctgtgtg gctgaggcac tgctctgcaa
     9241 cggccaggat gactgtggcg acagctcgga cgagcgtggc tgccacatca atgagtgtct
     9301 cagccgcaag ctcagtggct gcagccagga ctgtgaggac ctcaagatcg gcttcaagtg
     9361 ccgctgtcgc cctggcttcc ggctgaagga tgacggccgg acgtgtgctg atgtggacga
     9421 gtgcagcacc accttcccct gcagccagcg ctgcatcaac acccatggca gctataagtg
     9481 tctgtgtgtg gagggctatg caccccgcgg cggcgacccc cacagctgca aggctgtgac
     9541 tgacgaggaa ccgtttctga tcttcgccaa ccggtactac ctgcgcaagc tcaacctgga
     9601 cgggtccaac tacacgttac ttaagcaggg cctgaacaac gccgttgcct tggattttga
     9661 ctaccgagag cagatgatct actggacaga tgtgaccacc cagggcagca tgatccgaag
     9721 gatgcacctt aacgggagca atgtgcaggt cctacaccgt acaggcctca gcaaccccga
     9781 tgggctggct gtggactggg tgggtggcaa cctgtactgg tgcgacaaag gccgggacac
     9841 catcgaggtg tccaagctca atggggccta tcggacggtg ctggtcagct ctggcctccg
     9901 tgagcccagg gctctggtgg tggatgtgca gaatgggtac ctgtactgga cagactgggg
     9961 tgaccattca ctgatcggcc gcatcggcat ggatgggtcc agccgcagcg tcatcgtgga
    10021 caccaagatc acatggccca atggcctgac gctggactat gtcactgagc gcatctactg
    10081 ggccgacgcc cgcgaggact acattgaatt tgccagcctg gatggctcca atcgccacgt
    10141 tgtgctgagc caggacatcc cgcacatctt tgcactgacc ctgtttgagg actacgtcta
    10201 ctggaccgac tgggaaacaa agtccattaa ccgagcccac aagaccacgg gcaccaacaa
    10261 aacgctcctc atcagcacgc tgcaccggcc catggacctg catgtcttcc atgccctgcg
    10321 ccagccagac gtgcccaatc acccctgcaa ggtcaacaat ggtggctgca gcaacctgtg
    10381 cctgctgtcc cccgggggag ggcacaaatg tgcctgcccc accaacttct acctgggcag
    10441 cgatgggcgc acctgtgtgt ccaactgcac ggctagccag tttgtatgca agaacgacaa
    10501 gtgcatcccc ttctggtgga agtgtgacac cgaggacgac tgcggggacc actcagacga
    10561 gcccccggac tgccctgagt tcaagtgccg gcccggacag ttccagtgct ccacaggtat
    10621 ctgcacaaac cctgccttca tctgcgatgg cgacaatgac tgccaggaca acagtgacga
    10681 ggccaactgt gacatccacg tctgcttgcc cagtcagttc aaatgcacca acaccaaccg
    10741 ctgtattccc ggcatcttcc gctgcaatgg gcaggacaac tgcggagatg gggaggatga
    10801 gagggactgc cccgaggtga cctgcgcccc caaccagttc cagtgctcca ttaccaaacg
    10861 gtgcatcccc cgggtctggg tctgcgaccg ggacaatgac tgtgtggatg gcagtgatga
    10921 gcccgccaac tgcacccaga tgacctgtgg tgtggacgag ttccgctgca aggattcggg
    10981 ccgctgcatc ccagcgcgtt ggaagtgtga cggagaggat gactgtgggg atggctcgga
    11041 tgagcccaag gaagagtgtg atgaacgcac ctgtgagcca taccagttcc gctgcaagaa
    11101 caaccgctgc gtgcccggcc gctggcagtg cgactacgac aacgattgcg gtgacaactc
    11161 cgatgaagag agctgcaccc ctcggccctg ctccgagagt gagttctcct gtgccaacgg
    11221 ccgctgcatc gcggggcgct ggaaatgcga tggagaccac gactgcgcgg acggctcgga
    11281 cgagaaagac tgcacccccc gctgtgacat ggaccagttc cagtgcaaga gcggccactg
    11341 catccccctg cgctggcgct gtgacgcaga cgccgactgc atggacggca gcgacgagga
    11401 ggcctgcggc actggcgtgc ggacctgccc cctggacgag ttccagtgca acaacacctt
    11461 gtgcaagccg ctggcctgga agtgcgatgg cgaggatgac tgtggggaca actcagatga
    11521 gaaccccgag gagtgtgccc ggttcgtgtg ccctcccaac cggcccttcc gttgcaagaa
    11581 tgaccgcgtc tgtctgtgga tcgggcgcca atgcgatggc acggacaact gtggggatgg
    11641 gactgatgaa gaggactgtg agccccccac agcccacacc acccactgca aagacaagaa
    11701 ggagtttctg tgccggaacc agcgctgcct ctcctcctcc ctgcgctgca acatgttcga
    11761 tgactgcggg gacggctctg acgaggagga ctgcagcatc gaccccaagc tgaccagctg
    11821 cgccaccaat gccagcatct gtggggacga ggcacgctgc gtgcgcaccg agaaagcggc
    11881 ctactgtgcc tgccgctcgg gcttccacac cgtgcccggc cagcccggat gccaagacat
    11941 caacgagtgc ctgcgcttcg gcacctgctc ccagctctgc aacaacacca agggcggcca
    12001 cctctgcagc tgcgctcgga acttcatgaa gacgcacaac acctgcaagg ccgaaggctc
    12061 tgagtaccag gtcctgtaca tcgctgatga caatgagatc cgcagcctgt tccccggcca
    12121 cccccattcg gcttacgagc aggcattcca gggtgacgag agtgtccgca ttgatgctat
    12181 ggatgtccat gtcaaggctg gccgtgtcta ttggaccaac tggcacacgg gcaccatctc
    12241 ctaccgcagc ctgccacctg ctgcgcctcc taccacttcc aaccgccacc ggcgacagat
    12301 tgaccggggt gtcacccacc tcaacatttc agggctgaag atgcccagag gcatcgccat
    12361 cgactgggtg gccggaaacg tgtactggac cgactcgggc cgagatgtga ttgaggtggc
    12421 gcagatgaag ggcgagaacc gcaagacgct catctcgggc atgattgacg agccccacgc
    12481 cattgtggtg gacccactga gggggaccat gtactggtca gactggggca accaccccaa
    12541 gattgagacg gcagcgatgg atgggacgct tcgggagaca ctggtgcagg acaacattca
    12601 gtggcccaca ggcctggccg tggattatca caatgagcgg ctgtactggg cagacgccaa
    12661 gctttcagtc atcggcagca tccggctcaa tggcacggac cccattgtgg ctgctgacag
    12721 caaacgaggc ctaagtcacc ccttcagcat cgacgtcttt gaggattaca tctatggtgt
    12781 cacctacatc aataatcgtg tcttcaagat ccataagttt ggccacagcc ccttggtcaa
    12841 cctgacaggg ggcctgagcc acgcctctga cgtggtcctt taccatcagc acaagcagcc
    12901 cgaagtgacc aacccatgtg accgcaagaa atgcgagtgg ctctgcctgc tgagccccag
    12961 tgggcctgtc tgcacctgtc ccaatgggaa gcggctggac aacggcacat gcgtgcctgt
    13021 gccctctcca acgccccccc cagatgctcc ccggcctgga acctgtaacc tgcagtgctt
    13081 caacggtggc agctgtttcc tcaatgcacg gaggcagccc aagtgccgct gccaaccccg
    13141 ctacacgggt gacaagtgtg aactggacca gtgctgggag cactgtcgca atgggggcac
    13201 ctgtgctgcc tccccctctg gcatgcccac gtgccggtgc cccacgggct tcacgggccc
    13261 caaatgcacc cagcaggtgt gtgcgggcta ctgtgccaac aacagcacct gcactgtcaa
    13321 ccagggcaac cagccccagt gccgatgcct acccggcttc ctgggcgacc gctgccagta
    13381 ccggcagtgc tctggctact gtgagaactt tggcacatgc cagatggctg ctgatggctc
    13441 ccgacaatgc cgctgcactg cctactttga gggatcgagg tgtgaggtga acaagtgcag
    13501 ccgctgtctc gaaggggcct gtgtggtcaa caagcagagt ggggatgtca cctgcaactg
    13561 cacggatggc cgggtggccc ccagctgtct gacctgcgtc ggccactgca gcaatggcgg
    13621 ctcctgtacc atgaacagca aaatgatgcc tgagtgccag tgcccacccc acatgacagg
    13681 gccccggtgt gaggagcacg tcttcagcca gcagcagcca ggacatatag cctccatcct
    13741 aatccctctg ctgttgctgc tgctgctggt tctggtggcc ggagtggtat tctggtataa
    13801 gcggcgagtc caaggggcta agggcttcca gcaccaacgg atgaccaacg gggccatgaa
    13861 cgtggagatt ggaaacccca cctacaagat gtacgaaggc ggagagcctg atgatgtggg
    13921 aggcctactg gacgctgact ttgccctgga ccctgacaag cccaccaact tcaccaaccc
    13981 cgtgtatgcc acactctaca tggggggcca tggcagtcgc cactccctgg ccagcacgga
    14041 cgagaagcga gaactcctgg gccggggccc tgaggacgag ataggggacc ccttggcata
    14101 gggccctgcc ccgtcggact gcccccagaa agcctcctgc cccctgccgg tgaagtcctt
    14161 cagtgagccc ctccccagcc agcccttccc tggccccgcc ggatgtataa atgtaaaaat
    14221 gaaggaatta cattttatat gtgagcgagc aagccggcaa gcgagcacag tattatttct
    14281 ccatcccctc cctgcctgct ccttggcacc cccatgctgc cttcagggag acaggcaggg
    14341 agggcttggg gctgcacctc ctaccctccc accagaacgc accccactgg gagagctggt
    14401 ggtgcagcct tcccctccct gtataagaca ctttgccaag gctctcccct ctcgccccat
    14461 ccctgcttgc ccgctcccac agcttcctga gggctaattc tgggaaggga gagttctttg
    14521 ctgcccctgt ctggaagacg tggctctggg tgaggtaggc gggaaaggat ggagtgtttt
    14581 agttcttggg ggaggccacc ccaaacccca gccccaactc caggggcacc tatgagatgg
    14641 ccatgctcaa cccccctccc agacaggccc tccctgtctc cagggccccc accgaggttc
    14701 ccagggctgg agacttcctc tggtaaacat tcctccagcc tcccctcccc tggggacgcc
    14761 aaggaggtgg gccacaccca ggaagggaaa gcgggcagcc ccgttttggg gacgtgaacg
    14821 ttttaataat ttttgctgaa ttctttacaa ctaaataaca cagatattct tataaataaa
    14881 attgtaaaaa aaaaaa
//