LOCUS       X06538                  1920 bp    mRNA    linear   HUM 12-SEP-1993
DEFINITION  Human mRNA for retinoic acid receptor.
ACCESSION   X06538
VERSION     X06538.1
KEYWORDS    DNA binding protein; hormone receptor; receptor; retinoic acid
            receptor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 260 to 1920)
  AUTHORS   Petkovich,M., Brand,N.J., Krust,A. and  Chambon,P.
  TITLE     A human retinoic acid receptor which belongs to the family of
            nuclear receptors
  JOURNAL   Nature 330(6147), 444-450(1987).
   PUBMED   2825025
REFERENCE   2  (bases 1 to 420)
  AUTHORS   Chambon,P.
  JOURNAL   Submitted (22-DEC-1988) to the INSDC.
COMMENT     cell line=MCF-7; library=lambda gt10; clone=p63;
FEATURES             Location/Qualifiers
     source          1..1920
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             317..1615
                     /note="retinoic acid receptor (AA 1 - 432)"
                     /db_xref="GOA:P10276"
                     /db_xref="HGNC:HGNC:9864"
                     /db_xref="InterPro:IPR000536"
                     /db_xref="InterPro:IPR001628"
                     /db_xref="InterPro:IPR001723"
                     /db_xref="InterPro:IPR003078"
                     /db_xref="InterPro:IPR008946"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="PDB:1DKF"
                     /db_xref="PDB:1DSZ"
                     /db_xref="PDB:3A9E"
                     /db_xref="PDB:3KMR"
                     /db_xref="PDB:3KMZ"
                     /db_xref="PDB:4DQM"
                     /db_xref="UniProtKB/Swiss-Prot:P10276"
                     /protein_id="CAA29787.1"
                     /translation="MLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPS
                     PPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCII
                     NKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEK
                     VRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPG
                     FTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLT
                     DLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVR
                     KRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDT
                     LSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP"
     misc_feature    488..685
                     /note="put. DNA-binding domain"
     old_sequence    763..764
                     /note="gc was cg in [1]"
                     /citation=[1]
     misc_feature    824..1483
                     /note="put. ligand-binding domain"
     old_sequence    1396..1396
                     /note="g was c in [1]"
                     /citation=[1]
     old_sequence    1733..1733
                     /note="g was c in [1]"
                     /citation=[1]
BASE COUNT          386 a          638 c          566 g          330 t
ORIGIN
        1 aattccctcc tggagccccc accctagctg ggggccaggt gggttggggg atgtctcaag
       61 agccggtcct ttggtcaagc agttctgtga gctggcactt ttcctgggaa ggtccagagc
      121 tggccttcag ggcaccaaaa aagatgccac tcctagatgg gccccagcta ggtggctgag
      181 ggggccatgt cctgtgatgc tcgcagcggg ggaagcaacc cgttcggggt gccagcgagc
      241 acagcgtctg ccctaacccg ggggcgggca cctcaatggg tacccggtgc ctccctacgc
      301 cttcttcttc ccccctatgc tgggtggact ctccccgcca ggcgctctga ccactctcca
      361 gcaccagctt ccagttagtg gatatagcac accatcccca gccaccattg agacccagag
      421 cagcagttct gaagagatag tgcccagccc tccctcgcca ccccctctac cccgcatcta
      481 caagccttgc tttgtctgtc aggacaagtc ctcaggctac cactatgggg tcagcgcctg
      541 tgagggctgc aagggcttct tccgccgcag catccagaag aacatggtgt acacgtgtca
      601 ccgggacaag aactgcatca tcaacaaggt gacccggaac cgctgccagt actgccgact
      661 gcagaagtgc tttgaagtgg gcatgtccaa ggagtctgtg agaaacgacc gaaacaagaa
      721 gaagaaggag gtgcccaagc ccgagtgctc tgagagctac acgctgacgc cggaggtggg
      781 ggagctcatt gagaaggtgc gtaaagcgca ccaggaaacc ttccctgccc tctgccagct
      841 gggcaaatac actacgaaca acagctcaga acaacgtgtc tctctggaca ttgacctctg
      901 ggacaagttc agtgaactct ccaccaagtg catcattaag actgtggagt tcgccaagca
      961 gctgcccggc ttcaccaccc tcaccatcgc cgaccagatc accctcctca aggctgcctg
     1021 cctggacatc ctgatcctgc ggatctgcac gcggtacacg cccgagcagg acaccatgac
     1081 cttctcggac gggctgaccc tgaaccggac ccagatgcac aacgctggct tcggccccct
     1141 caccgacctg gtctttgcct tcgccaacca gctgctgccc ctggagatgg atgatgcgga
     1201 gacggggctg ctcagcgcca tctgcctcat ctgcggagac cgccaggacc tggagcagcc
     1261 ggaccgggtg gacatgctgc aggagccgct gctggaggcg ctaaaggtct acgtgcggaa
     1321 gcggaggccc agccgccccc acatgttccc caagatgcta atgaagatta ctgacctgcg
     1381 aagcatcagc gccaaggggg ctgagcgggt gatcacgctg aagatggaga tcccgggctc
     1441 catgccgcct ctcatccagg aaatgttgga gaactcagag ggcctggaca ctctgagcgg
     1501 acagccgggg ggtggggggc gggacggggg tggcctggcc cccccgccag gcagctgtag
     1561 ccccagcctc agccccagct ccaacagaag cagcccggcc acccactccc cgtgaccgcc
     1621 cacgccacat ggacacagcc ctcgccctcc gccccggctt ttctctgcct ttctaccgac
     1681 catgtgaccc cgcaccagcc ctgcccccac ctgccctgcc cgggagtact ggggaccttc
     1741 cctgggggac ggggagggag gaggcagcga ctccttggac agaggcctgg gccctcagtg
     1801 gactgcctgc tcccacagcc tgggctgacg tcagaggccg aggccaggaa ctgagtgagg
     1861 cccctggtcc tgggtctcag gatgggtcct gggggcctcg tgttcatcaa gacggaattc
//