LOCUS       X04828                  1702 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  Human mRNA for G(i) protein alpha-subunit (adenylate cyclase
            inhibiting GTP-binding protein).
ACCESSION   X04828
VERSION     X04828.1
KEYWORDS    adenylate cyclase-inhibiting GTP-binding protein; G protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1702)
  AUTHORS   Didsbury J.R., Ho Y.S., Snyderman R.
  TITLE     Human Gi protein alpha-subunit: deduction of amino acid structure
            from a cloned cDNA
  JOURNAL   FEBS Lett. 211(2), 160-164(1987).
   PUBMED   3100330
COMMENT     The poly(A) site was determined 38 bp 3' to the 3' terminus
            of pJD43.
            Four pot. GTP binding and hydrolysis sites are found at the
            AA pos. 32-49, 200-206, 222-230 and 265-278.
            
            Data kindly reviewed (24-APR-1987) by J. Didsbury
FEATURES             Location/Qualifiers
     source          1..1702
                     /db_xref="H-InvDB:HIT000321071"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone="pJD43."
                     /cell_line="U937"
                     /db_xref="taxon:9606"
     CDS             124..1191
                     /note="G protein alpha-subunit (AA 1-355)"
                     /db_xref="GOA:P04899"
                     /db_xref="H-InvDB:HIT000321071.14"
                     /db_xref="HGNC:HGNC:4385"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR001408"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:P04899"
                     /protein_id="CAA28512.1"
                     /translation="MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGES
                     GKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRAD
                     DARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDL
                     ERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEG
                     VTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFE
                     EKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQ
                     FVFDAVTDVIIKNNLKDCGLF"
BASE COUNT          375 a          504 c          506 g          317 t
ORIGIN      
        1 ccggcagtcc cgagtgcttc ccgcagaggg ctggtggtgg gagcggagtg gagtcgggcg
       61 gggccgaagc cgggccgtgg gcgtagatgg gggccgggcg gcggcggagc ggcggaacgc
      121 gggatgggct gcaccgtgag cgccgaggac aaggcggcgg ccgagcgctc taagatgatc
      181 gacaagaacc tgcgggagga cggagagaag gcggcgcggg aggtgaagtt gctgctgttg
      241 ggtgctgggg agtcagggaa gagcaccatc gtcaagcaga tgaagatcat ccacgaggat
      301 ggctactccg aggaggaatg ccggcagtac cgggcggttg tctacagcaa caccatccag
      361 tccatcatgg ccattgtcaa agccatggga aacctgcaga tcgactttgc cgacccctcc
      421 agagcggacg acgccaggca gctatttgca ctgtcctgca ccgccgagga gcaaggcgtg
      481 ctccctgatg acctgtccgg cgtcatccgg aggctctggg ctgaccatgg tgtgcaggcc
      541 tgctttggcc gctcaaggga ataccagctc aacgactcag ctgcctacta cctgaacgac
      601 ctggagcgta ttgcacagag tgactacatc cccacacagc aagatgtgct acggacccgc
      661 gtaaagacca cggggatcgt ggagacacac ttcaccttca aggacctaca cttcaagatg
      721 tttgatgtgg gtggtcagcg gtctgagcgg aagaagtgga tccactgctt tgagggcgtc
      781 acagccatca tcttctgcgt agccttgagc gcctatgact tggtgctagc tgaggacgag
      841 gagatgaacc gcatgcatga gagcatgaag ctattcgata gcatctgcaa caacaagtgg
      901 ttcacagaca cgtccatcat cctcttcctc aacaagaagg acctgtttga ggagaagatc
      961 acacacagtc ccctgaccat ctgcttccct gagtacacag gggccaacaa atatgatgag
     1021 gcagccagct acatccagag taagtttgag gacctgaata agcgcaaaga caccaaggag
     1081 atctacacgc acttcacgtg cgccaccgac accaagaacg tgcagttcgt gtttgacgcc
     1141 gtcaccgatg tcatcatcaa gaacaacctg aaggactgcg gcctcttctg aggggcagcg
     1201 gggcctggcg ggatgggcca ccgccgaatt tgtacccccc aacccctgag gaagatgggg
     1261 gcaagaagat cacgctcccc gcctgttccc ccgccgcttt tctcctcttt cctctctttg
     1321 ttctcagctc cccctgtccc ctcagctcca aacgtagggg aggggttcgc acaggcctcc
     1381 ctgtttgaag cctgcccttg tctgagatgc tggtaatggc catggtaccc ccttctgggc
     1441 atctgttctg gtttttaacc attgtcttgt tctgtgatga ggggaggggg gcacatgctg
     1501 agtctcccaa ggctgcgtct ggaggggccc ctgcttctcc agcctggacc cccagctttg
     1561 cccaacacca gcccctgccc cagcccaagt ccaaatgttt acgggagcct cctgcccagt
     1621 cccccaaccc cagccgctcg gaggccccaa aggaaaaagc acaagaagcg tgagacgcca
     1681 ccattcctgg aaaccacagt cc
//