LOCUS       X03635                  6450 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for oestrogen receptor.
ACCESSION   X03635 M11457
VERSION     X03635.1
KEYWORDS    estrogen receptor; receptor; steroid hormone receptor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6450)
  AUTHORS   Green S., Walter P., Kumar V., Krust A., Bornert J.M., Argos P.,
            Chambon P.
  TITLE     Human oestrogen receptor cDNA: sequence, expression and homology to
            v-erb-A
  JOURNAL   Nature 320(6058), 134-139(1986).
   PUBMED   3754034
COMMENT     Data kindly reviewed (28-OCT-1986) by P. Chambon
FEATURES             Location/Qualifiers
     source          1..6450
                     /db_xref="H-InvDB:HIT000320987"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     misc_feature    26..32
                     /note="CAAT-box"
     misc_feature    102..109
                     /note="TATA-box"
     misc_RNA        129..129
                     /note="cap site"
     CDS             247..309
                     /product="hypothetical protein"
                     /note="ORF"
                     /db_xref="H-InvDB:HIT000320987.14"
                     /db_xref="UniProtKB/TrEMBL:A0A4R1"
                     /protein_id="CAD97416.1"
                     /translation="MRCVASNLGLCSFSRWPAGF"
     CDS             361..2148
                     /product="oestrogen receptor"
                     /db_xref="GOA:P03372"
                     /db_xref="HGNC:HGNC:3467"
                     /db_xref="InterPro:IPR000536"
                     /db_xref="InterPro:IPR001292"
                     /db_xref="InterPro:IPR001628"
                     /db_xref="InterPro:IPR001723"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR024178"
                     /db_xref="InterPro:IPR024736"
                     /db_xref="PDB:1A52"
                     /db_xref="PDB:1AKF"
                     /db_xref="PDB:1ERE"
                     /db_xref="PDB:1ERR"
                     /db_xref="PDB:1G50"
                     /db_xref="PDB:1GWQ"
                     /db_xref="PDB:1GWR"
                     /db_xref="PDB:1HCP"
                     /db_xref="PDB:1HCQ"
                     /db_xref="PDB:1L2I"
                     /db_xref="PDB:1PCG"
                     /db_xref="PDB:1QKT"
                     /db_xref="PDB:1QKU"
                     /db_xref="PDB:1R5K"
                     /db_xref="PDB:1SJ0"
                     /db_xref="PDB:1UOM"
                     /db_xref="PDB:1X7E"
                     /db_xref="PDB:1X7R"
                     /db_xref="PDB:1XP1"
                     /db_xref="PDB:1XP6"
                     /db_xref="PDB:1XP9"
                     /db_xref="PDB:1XPC"
                     /db_xref="PDB:1XQC"
                     /db_xref="PDB:1YIM"
                     /db_xref="PDB:1YIN"
                     /db_xref="PDB:1ZKY"
                     /db_xref="PDB:2AYR"
                     /db_xref="PDB:2B1V"
                     /db_xref="PDB:2B1Z"
                     /db_xref="PDB:2B23"
                     /db_xref="PDB:2BJ4"
                     /db_xref="PDB:2FAI"
                     /db_xref="PDB:2G44"
                     /db_xref="PDB:2G5O"
                     /db_xref="PDB:2I0J"
                     /db_xref="PDB:2IOG"
                     /db_xref="PDB:2IOK"
                     /db_xref="PDB:2JF9"
                     /db_xref="PDB:2JFA"
                     /db_xref="PDB:2LLO"
                     /db_xref="PDB:2LLQ"
                     /db_xref="PDB:2OCF"
                     /db_xref="PDB:2OUZ"
                     /db_xref="PDB:2P15"
                     /db_xref="PDB:2POG"
                     /db_xref="PDB:2Q6J"
                     /db_xref="PDB:2Q70"
                     /db_xref="PDB:2QA6"
                     /db_xref="PDB:2QA8"
                     /db_xref="PDB:2QAB"
                     /db_xref="PDB:2QE4"
                     /db_xref="PDB:2QGT"
                     /db_xref="PDB:2QGW"
                     /db_xref="PDB:2QH6"
                     /db_xref="PDB:2QR9"
                     /db_xref="PDB:2QSE"
                     /db_xref="PDB:2QXM"
                     /db_xref="PDB:2QXS"
                     /db_xref="PDB:2QZO"
                     /db_xref="PDB:2R6W"
                     /db_xref="PDB:2R6Y"
                     /db_xref="PDB:2YAT"
                     /db_xref="PDB:2YJA"
                     /db_xref="PDB:3CBM"
                     /db_xref="PDB:3CBO"
                     /db_xref="PDB:3CBP"
                     /db_xref="PDB:3DT3"
                     /db_xref="PDB:3ERD"
                     /db_xref="PDB:3ERT"
                     /db_xref="PDB:3HLV"
                     /db_xref="PDB:3HM1"
                     /db_xref="PDB:3L03"
                     /db_xref="PDB:3OS8"
                     /db_xref="PDB:3OS9"
                     /db_xref="PDB:3OSA"
                     /db_xref="PDB:3Q95"
                     /db_xref="PDB:3Q97"
                     /db_xref="PDB:3UU7"
                     /db_xref="PDB:3UUA"
                     /db_xref="PDB:3UUC"
                     /db_xref="PDB:3UUD"
                     /db_xref="PDB:4AA6"
                     /db_xref="PDB:4DMA"
                     /db_xref="PDB:4IU7"
                     /db_xref="PDB:4IUI"
                     /db_xref="PDB:4IV2"
                     /db_xref="PDB:4IV4"
                     /db_xref="PDB:4IVW"
                     /db_xref="PDB:4IVY"
                     /db_xref="PDB:4IW6"
                     /db_xref="PDB:4IW8"
                     /db_xref="PDB:4IWC"
                     /db_xref="PDB:4IWF"
                     /db_xref="PDB:4JC3"
                     /db_xref="PDB:4JDD"
                     /db_xref="PDB:4MG5"
                     /db_xref="PDB:4MG6"
                     /db_xref="PDB:4MG7"
                     /db_xref="PDB:4MG8"
                     /db_xref="PDB:4MG9"
                     /db_xref="PDB:4MGA"
                     /db_xref="PDB:4MGB"
                     /db_xref="PDB:4MGC"
                     /db_xref="PDB:4MGD"
                     /db_xref="PDB:4O6F"
                     /db_xref="PDB:4PP6"
                     /db_xref="PDB:4PPP"
                     /db_xref="PDB:4PPS"
                     /db_xref="PDB:4PXM"
                     /db_xref="PDB:4Q13"
                     /db_xref="PDB:4Q50"
                     /db_xref="PDB:4TUZ"
                     /db_xref="PDB:4TV1"
                     /db_xref="PDB:4XI3"
                     /db_xref="PDB:4ZN7"
                     /db_xref="PDB:4ZN9"
                     /db_xref="PDB:4ZNH"
                     /db_xref="PDB:4ZNS"
                     /db_xref="PDB:4ZNT"
                     /db_xref="PDB:4ZNU"
                     /db_xref="PDB:4ZNV"
                     /db_xref="PDB:4ZNW"
                     /db_xref="PDB:5AAU"
                     /db_xref="PDB:5AAV"
                     /db_xref="PDB:5ACC"
                     /db_xref="PDB:5AK2"
                     /db_xref="PDB:5DI7"
                     /db_xref="PDB:5DID"
                     /db_xref="PDB:5DIE"
                     /db_xref="PDB:5DIG"
                     /db_xref="PDB:5DK9"
                     /db_xref="PDB:5DKB"
                     /db_xref="PDB:5DKE"
                     /db_xref="PDB:5DKG"
                     /db_xref="PDB:5DKS"
                     /db_xref="PDB:5DL4"
                     /db_xref="PDB:5DLR"
                     /db_xref="PDB:5DMC"
                     /db_xref="PDB:5DMF"
                     /db_xref="PDB:5DP0"
                     /db_xref="PDB:5DRJ"
                     /db_xref="PDB:5DRM"
                     /db_xref="PDB:5DTV"
                     /db_xref="PDB:5DU5"
                     /db_xref="PDB:5DUE"
                     /db_xref="PDB:5DUG"
                     /db_xref="PDB:5DUH"
                     /db_xref="PDB:5DVS"
                     /db_xref="PDB:5DVV"
                     /db_xref="PDB:5DWE"
                     /db_xref="PDB:5DWG"
                     /db_xref="PDB:5DWI"
                     /db_xref="PDB:5DWJ"
                     /db_xref="PDB:5DX3"
                     /db_xref="PDB:5DXB"
                     /db_xref="PDB:5DXE"
                     /db_xref="PDB:5DXG"
                     /db_xref="PDB:5DXK"
                     /db_xref="PDB:5DXM"
                     /db_xref="PDB:5DXP"
                     /db_xref="PDB:5DXQ"
                     /db_xref="PDB:5DXR"
                     /db_xref="PDB:5DY8"
                     /db_xref="PDB:5DYB"
                     /db_xref="PDB:5DYD"
                     /db_xref="PDB:5DZ0"
                     /db_xref="PDB:5DZ1"
                     /db_xref="PDB:5DZ3"
                     /db_xref="PDB:5DZH"
                     /db_xref="PDB:5DZI"
                     /db_xref="PDB:5E0W"
                     /db_xref="PDB:5E0X"
                     /db_xref="PDB:5E14"
                     /db_xref="PDB:5E15"
                     /db_xref="PDB:5E19"
                     /db_xref="PDB:5E1C"
                     /db_xref="PDB:5EGV"
                     /db_xref="PDB:5EHJ"
                     /db_xref="PDB:5EI1"
                     /db_xref="PDB:5EIT"
                     /db_xref="PDB:5FQP"
                     /db_xref="PDB:5FQR"
                     /db_xref="PDB:5FQS"
                     /db_xref="PDB:5FQT"
                     /db_xref="PDB:5FQV"
                     /db_xref="PDB:5HYR"
                     /db_xref="PDB:5KCC"
                     /db_xref="PDB:5KCD"
                     /db_xref="PDB:5KCE"
                     /db_xref="PDB:5KCF"
                     /db_xref="PDB:5KCT"
                     /db_xref="PDB:5KCU"
                     /db_xref="PDB:5KCW"
                     /db_xref="PDB:5KD9"
                     /db_xref="UniProtKB/Swiss-Prot:P03372"
                     /protein_id="CAA27284.1"
                     /translation="MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYL
                     DSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNS
                     VSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQG
                     GRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHND
                     YMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEG
                     RGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPT
                     RPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLV
                     WRSMEHPVKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKS
                     IILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLL
                     LILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQS
                     HLATAGSTSSHSLQKYYITGEAEGFPATV"
     misc_feature    442..456
                     /note="pot. nuclear transfer signal"
     misc_feature    4550..4555
                     /note="pot. alternate polyA signal"
     misc_feature    5625..5630
                     /note="pot. alternate polyA signal"
     regulatory      6435..6440
                     /regulatory_class="polyA_signal_sequence"
     polyA_site      6450..6450
BASE COUNT         1642 a         1496 c         1534 g         1778 t
ORIGIN      
        1 gagttgtgcc tggagtgatg tttaagccaa tgtcagggca aggcaacagt ccctggccgt
       61 cctccagcac ctttgtaatg catatgagct cgggagacca gtacttaaag ttggaggccc
      121 gggagcccag gagctggcgg agggcgttcg tcctgggagc tgcacttgct ccgtcgggtc
      181 gccggcttca ccggaccgca ggctcccggg gcagggccgg ggccagagct cgcgtgtcgg
      241 cgggacatgc gctgcgtcgc ctctaacctc gggctgtgct ctttttccag gtggcccgcc
      301 ggtttctgag ccttctgccc tgcggggaca cggtctgcac cctgcccgcg gccacggacc
      361 atgaccatga ccctccacac caaagcatct gggatggccc tactgcatca gatccaaggg
      421 aacgagctgg agcccctgaa ccgtccgcag ctcaagatcc ccctggagcg gcccctgggc
      481 gaggtgtacc tggacagcag caagcccgcc gtgtacaact accccgaggg cgccgcctac
      541 gagttcaacg ccgcggccgc cgccaacgcg caggtctacg gtcagaccgg cctcccctac
      601 ggccccgggt ctgaggctgc ggcgttcggc tccaacggcc tggggggttt ccccccactc
      661 aacagcgtgt ctccgagccc gctgatgcta ctgcacccgc cgccgcagct gtcgcctttc
      721 ctgcagcccc acggccagca ggtgccctac tacctggaga acgagcccag cggctacacg
      781 gtgcgcgagg ccggcccgcc ggcattctac aggccaaatt cagataatcg acgccagggt
      841 ggcagagaaa gattggccag taccaatgac aagggaagta tggctatgga atctgccaag
      901 gagactcgct actgtgcagt gtgcaatgac tatgcttcag gctaccatta tggagtctgg
      961 tcctgtgagg gctgcaaggc cttcttcaag agaagtattc aaggacataa cgactatatg
     1021 tgtccagcca ccaaccagtg caccattgat aaaaacagga ggaagagctg ccaggcctgc
     1081 cggctccgca aatgctacga agtgggaatg atgaaaggtg ggatacgaaa agaccgaaga
     1141 ggagggagaa tgttgaaaca caagcgccag agagatgatg gggagggcag gggtgaagtg
     1201 gggtctgctg gagacatgag agctgccaac ctttggccaa gcccgctcat gatcaaacgc
     1261 tctaagaaga acagcctggc cttgtccctg acggccgacc agatggtcag tgccttgttg
     1321 gatgctgagc cccccatact ctattccgag tatgatccta ccagaccctt cagtgaagct
     1381 tcgatgatgg gcttactgac caacctggca gacagggagc tggttcacat gatcaactgg
     1441 gcgaagaggg tgccaggctt tgtggatttg accctccatg atcaggtcca ccttctagaa
     1501 tgtgcctggc tagagatcct gatgattggt ctcgtctggc gctccatgga gcacccagtg
     1561 aagctactgt ttgctcctaa cttgctcttg gacaggaacc agggaaaatg tgtagagggc
     1621 atggtggaga tcttcgacat gctgctggct acatcatctc ggttccgcat gatgaatctg
     1681 cagggagagg agtttgtgtg cctcaaatct attattttgc ttaattctgg agtgtacaca
     1741 tttctgtcca gcaccctgaa gtctctggaa gagaaggacc atatccaccg agtcctggac
     1801 aagatcacag acactttgat ccacctgatg gccaaggcag gcctgaccct gcagcagcag
     1861 caccagcggc tggcccagct cctcctcatc ctctcccaca tcaggcacat gagtaacaaa
     1921 ggcatggagc atctgtacag catgaagtgc aagaacgtgg tgcccctcta tgacctgctg
     1981 ctggagatgc tggacgccca ccgcctacat gcgcccacta gccgtggagg ggcatccgtg
     2041 gaggagacgg accaaagcca cttggccact gcgggctcta cttcatcgca ttccttgcaa
     2101 aagtattaca tcacggggga ggcagagggt ttccctgcca cagtctgaga gctccctggc
     2161 tcccacacgg ttcagataat ccctgctgca ttttaccctc atcatgcacc actttagcca
     2221 aattctgtct cctgcataca ctccggcatg catccaacac caatggcttt ctagatgagt
     2281 ggccattcat ttgcttgctc agttcttagt ggcacatctt ctgtcttctg ttgggaacag
     2341 ccaaagggat tccaaggcta aatctttgta acagctctct ttcccccttg ctatgttact
     2401 aagcgtgagg attcccgtag ctcttcacag ctgaactcag tctatgggtt ggggctcaga
     2461 taactctgtg catttaagct acttgtagag acccaggcct ggagagtaga cattttgcct
     2521 ctgataagca ctttttaaat ggctctaaga ataagccaca gcaaagaatt taaagtggct
     2581 cctttaattg gtgacttgga gaaagctagg tcaagggttt attatagcac cctcttgtat
     2641 tcctatggca atgcatcctt ttatgaaagt ggtacacctt aaagctttta tatgactgta
     2701 gcagagtatc tggtgattgt caattcactt ccccctatag gaatacaagg ggccacacag
     2761 ggaaggcaga tcccctagtt ggccaagact tattttaact tgatacactg cagattcaga
     2821 gtgtcctgaa gctctgcctc tggctttccg gtcatgggtt ccagttaatt catgcctccc
     2881 atggacctat ggagagcaac aagttgatct tagttaagtc tccctatatg agggataagt
     2941 tcctgatttt tgtttttatt tttgtgttac aaaagaaagc cctccctccc tgaacttgca
     3001 gtaaggtcag cttcaggacc tgttccagtg ggcactgtac ttggatcttc ccggcgtgtg
     3061 tgtgccttac acaggggtga actgttcact gtggtgatgc atgatgaggg taaatggtag
     3121 ttgaaaggag caggggccct ggtgttgcat ttagccctgg ggcatggagc tgaacagtac
     3181 ttgtgcagga ttgttgtggc tactagagaa caagagggaa agtagggcag aaactggata
     3241 cagttctgag cacagccaga cttgctcagg tggccctgca caggctgcag ctacctagga
     3301 acattccttg cagaccccgc attgcctttg ggggtgccct gggatccctg gggtagtcca
     3361 gctcttattc atttcccagc gtggccctgg ttggaagaag cagctgtcaa gttgtagaca
     3421 gctgtgttcc tacaattggc ccagcaccct ggggcacggg agaagggtgg ggaccgttgc
     3481 tgtcactact caggctgact ggggcctggt cagattacgt atgcccttgg tggtttagag
     3541 ataatccaaa atcagggttt ggtttgggga agaaaatcct cccccttcct cccccgcccc
     3601 gttccctacc gcctccactc ctgccagctc atttccttca atttcctttg acctataggc
     3661 taaaaaagaa aggctcattc cagccacagg gcagccttcc ctgggccttt gcttctctag
     3721 cacaattatg ggttacttcc tttttcttaa caaaaaagaa tgtttgattt cctctgggtg
     3781 accttattgt ctgtaattga aaccctattg agaggtgatg tctgtgttag ccaatgaccc
     3841 aggtagctgc tcgggcttct cttggtatgt cttgtttgga aaagtggatt tcattcattt
     3901 ctgattgtcc agttaagtga tcaccaaagg actgagaatc tgggagggca aaaaaaaaaa
     3961 aaaaagtttt tatgtgcact taaatttggg gacaatttta tgtatctgtg ttaaggatat
     4021 gcttaagaac ataattcttt tgttgctgtt tgtttaagaa gcaccttagt ttgtttaaga
     4081 agcaccttat atagtataat atatattttt ttgaaattac attgcttgtt tatcagacaa
     4141 ttgaatgtag taattctgtt ctggatttaa tttgactggg ttaacatgca aaaaccaagg
     4201 aaaaatattt agtttttttt tttttttttg tatacttttc aagctacctt gtcatgtata
     4261 cagtcattta tgcctaaagc ctggtgatta ttcatttaaa tgaagatcac atttcatatc
     4321 aacttttgta tccacagtag acaaaatagc actaatccag atgcctattg ttggatattg
     4381 aatgacagac aatcttatgt agcaaagatt atgcctgaaa aggaaaatta ttcagggcag
     4441 ctaattttgc ttttaccaaa atatcagtag taatattttt ggacagtagc taatgggtca
     4501 gtgggttctt tttaatgttt atacttagat tttcttttaa aaaaattaaa ataaaacaaa
     4561 aaaaatttct aggactagac gatgtaatac cagctaaagc caaacaatta tacagtggaa
     4621 ggttttacat tattcatcca atgtgtttct attcatgtta agatactact acatttgaag
     4681 tgggcagaga acatcagatg attgaaatgt tcgcccaggg gtctccagca actttggaaa
     4741 tctctttgta tttttacttg aagtgccact aatggacagc agatattttc tggctgatgt
     4801 tggtattggg tgtaggaaca tgatttaaaa aaaaaactct tgcctctgct ttcccccact
     4861 ctgaggcaag ttaaaatgta aaagatgtga tttatctggg gggctcaggt atggtgggga
     4921 agtggattca ggaatctggg gaatggcaaa tatattaaga agagtattga aagtatttgg
     4981 aggaaaatgg ttaattctgg gtgtgcacca aggttcagta gagtccactt ctgccctgga
     5041 gaccacaaat caactagctc catttacagc catttctaaa atggcagctt cagttctaga
     5101 gaagaaagaa caacatcagc agtaaagtcc atggaatagc tagtggtctg tgtttctttt
     5161 cgccattgcc tagcttgccg taatgattct ataatgccat catgcagcaa ttatgagagg
     5221 ctaggtcatc caaagagaag accctatcaa tgtaggttgc aaaatctaac ccctaaggaa
     5281 gtgcagtctt tgatttgatt tccctagtaa ccttgcagat atgtttaacc aagccatagc
     5341 ccatgccttt tgagggctga acaaataagg gacttactga taatttactt ttgatcacat
     5401 taaggtgttc tcaccttgaa atcttataca ctgaaatggc cattgattta ggccactggc
     5461 ttagagtact ccttcccctg catgacactg attacaaata ctttcctatt catactttcc
     5521 aattatgaga tggactgtgg gtactgggag tgatcactaa caccatagta atgtctaata
     5581 ttcacaggca gatctgcttg gggaagctag ttatgtgaaa ggcaaataaa gtcatacagt
     5641 agctcaaaag gcaaccataa ttctctttgg tgcaagtctt gggagcgtga tctagattac
     5701 actgcaccat tcccaagtta atcccctgaa aacttactct caactggagc aaatgaactt
     5761 tggtcccaaa tatccatctt ttcagtagcg ttaattatgc tctgtttcca actgcatttc
     5821 ctttccaatt gaattaaagt gtggcctcgt ttttagtcat ttaaaattgt tttctaagta
     5881 attgctgcct ctattatggc acttcaattt tgcactgtct tttgagattc aagaaaaatt
     5941 tctattcatt tttttgcatc caattgtgcc tgaactttta aaatatgtaa atgctgccat
     6001 gttccaaacc catcgtcagt gtgtgtgttt agagctgtgc accctagaaa caacatactt
     6061 gtcccatgag caggtgcctg agacacagac ccctttgcat tcacagagag gtcattggtt
     6121 atagagactt gaattaataa gtgacattat gccagtttct gttctctcac aggtgataaa
     6181 caatgctttt tgtgcactac atactcttca gtgtagagct cttgttttat gggaaaaggc
     6241 tcaaatgcca aattgtgttt gatggattaa tatgcccttt tgccgatgca tactattact
     6301 gatgtgactc ggttttgtcg cagctttgct ttgtttaatg aaacacactt gtaaacctct
     6361 tttgcacttt gaaaaagaat ccagcgggat gctcgagcac ctgtaaacaa ttttctcaac
     6421 ctatttgatg ttcaaataaa gaattaaact
//