LOCUS       X03453                  1553 bp    DNA     linear   PHG 23-OCT-2008
DEFINITION  Bacteriophage P1 cre gene for recombinase protein.
ACCESSION   X03453
VERSION     X03453.1
KEYWORDS    inverted repeat; recombinase; unidentified reading frame.
SOURCE      Escherichia virus P1
  ORGANISM  Escherichia virus P1
            Viruses; Caudovirales; Myoviridae; Punavirus.
REFERENCE   1  (bases 1 to 1553)
  AUTHORS   Sternberg N., Sauer B., Hoess R., Abremski K.
  TITLE     Bacteriophage P1 cre gene and its regulatory region. Evidence for
            multiple promoters and for regulation by DNA methylation
  JOURNAL   J. Mol. Biol. 187(2), 197-212(1986).
   PUBMED   3486297
FEATURES             Location/Qualifiers
     source          1..1553
                     /organism="Escherichia virus P1"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10678"
     misc_feature    35..68
                     /note="loxP recombination site"
     repeat_region   35..47
                     /note="inverted repeat"
     repeat_region   56..68
                     /note="inverted repeat"
     regulatory      147..152
                     /note="promoter pR1 put. -35 region"
                     /regulatory_class="promoter"
     regulatory      155..160
                     /note="promoter pR1 put. altern. -35 region"
                     /regulatory_class="promoter"
     regulatory      175..180
                     /note="promoter pR1 put. -10 region"
                     /regulatory_class="promoter"
     regulatory      245..252
                     /note="put. rRNA binding site"
                     /regulatory_class="ribosome_binding_site"
     CDS             256..477
                     /transl_table=11
                     /note="pot. ORF1 (aa 1-73)"
                     /db_xref="UniProtKB/TrEMBL:Q38403"
                     /protein_id="CAA27177.1"
                     /translation="MGYSTAKVSTHLELEKNRGYWRAKGFDRDSCQLSLSRGEEKIER
                     TRGRWRFYDENHKQVKAEPILYTLLKTII"
     regulatory      332..337
                     /note="promoter pR2 put. -35 region"
                     /regulatory_class="promoter"
     regulatory      356..361
                     /note="promoter pR2 put. -10 region"
                     /regulatory_class="promoter"
     regulatory      449..455
                     /note="promoter pR3 put. -35 region"
                     /regulatory_class="promoter"
     regulatory      468..473
                     /note="promoter pR3 put. -10 region"
                     /regulatory_class="promoter"
     regulatory      475..482
                     /note="put. rRNA-binding site"
                     /regulatory_class="ribosome_binding_site"
     CDS             485..1516
                     /transl_table=11
                     /note="ORF2, put. cre protein (aa 1-343)"
                     /db_xref="GOA:P06956"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR010998"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="PDB:1CRX"
                     /db_xref="PDB:1DRG"
                     /db_xref="PDB:1F44"
                     /db_xref="PDB:1KBU"
                     /db_xref="PDB:1MA7"
                     /db_xref="PDB:1NZB"
                     /db_xref="PDB:1OUQ"
                     /db_xref="PDB:1PVP"
                     /db_xref="PDB:1PVQ"
                     /db_xref="PDB:1PVR"
                     /db_xref="PDB:1Q3U"
                     /db_xref="PDB:1Q3V"
                     /db_xref="PDB:1XNS"
                     /db_xref="PDB:1XO0"
                     /db_xref="PDB:2CRX"
                     /db_xref="PDB:2HOF"
                     /db_xref="PDB:2HOI"
                     /db_xref="PDB:3C28"
                     /db_xref="PDB:3C29"
                     /db_xref="PDB:3CRX"
                     /db_xref="PDB:3MGV"
                     /db_xref="PDB:4CRX"
                     /db_xref="PDB:5CRX"
                     /db_xref="UniProtKB/Swiss-Prot:P06956"
                     /protein_id="CAA27178.1"
                     /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKM
                     LLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRS
                     GLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
                     LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVT
                     KLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAK
                     DDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGA
                     MVRLLEDGD"
BASE COUNT          424 a          340 c          394 g          395 t
ORIGIN      
        1 tgcgcagctg gacgtaaact cctcttcaga cctaataact tcgtatagca tacattatac
       61 gaagttatat taagggttat tgaatatgat caatttacct gtaaatccat acagttcaat
      121 accttagcag gtcaaatagt gaccacttga tcatttgatc aaggttgcgc tacgtaaaat
      181 ctgtgaaaaa ttggcggtgt tagtcctaca gatttcgcgt accacttagc accaccaatc
      241 aatcagaggt gaaaaatggg atattcaact gctaaagtgt ccactcatct tgagcttgag
      301 aaaaaccgtg gttactggcg ggcaaaaggg tttgatcgtg atagttgcca actgtcatta
      361 tcgcgcggtg aagagaaaat agaacgcacg cgcggtcgct ggcgtttcta tgacgagaac
      421 cataaacagg taaaggcaga gccgatcctg tacactttac ttaaaaccat tatctgagtg
      481 ttaaatgtcc aatttactga ccgtacacca aaatttgcct gcattaccgg tcgatgcaac
      541 gagtgatgag gttcgcaaga acctgatgga catgttcagg gatcgccagg cgttttctga
      601 gcatacctgg aaaatgcttc tgtccgtttg ccggtcgtgg gcggcatggt gcaagttgaa
      661 taaccggaaa tggtttcccg cagaacctga agatgttcgc gattatcttc tatatcttca
      721 ggcgcgcggt ctggcagtaa aaactatcca gcaacatttg ggccagctaa acatgcttca
      781 tcgtcggtcc gggctgccac gaccaagtga cagcaatgct gtttcactgg ttatgcggcg
      841 gatccgaaaa gaaaacgttg atgccggtga acgtgcaaaa caggctctag cgttcgaacg
      901 cactgatttc gaccaggttc gttcactcat ggaaaatagc gatcgctgcc aggatatacg
      961 taatctggca tttctgggga ttgcttataa caccctgtta cgtatagccg aaattgccag
     1021 gatcagggtt aaagatatct cacgtactga cggtgggaga atgttaatcc atattggcag
     1081 aacgaaaacg ctggttagca ccgcaggtgt agagaaggca cttagcctgg gggtaactaa
     1141 actggtcgag cgatggattt ccgtctctgg tgtagctgat gatccgaata actacctgtt
     1201 ttgccgggtc agaaaaaatg gtgttgccgc gccatctgcc accagccagc tatcaactcg
     1261 cgccctggaa gggatttttg aagcaactca tcgattgatt tacggcgcta aggatgactc
     1321 tggtcagaga tacctggcct ggtctggaca cagtgcccgt gtcggagccg cgcgagatat
     1381 ggcccgcgct ggagtttcaa taccggagat catgcaagct ggtggctgga ccaatgtaaa
     1441 tattgtcatg aactatatcc gtaacctgga tagtgaaaca ggggcaatgg tgcgcctgct
     1501 ggaagatggc gattagccat taacgcgtaa atgattgcta taattagttg ata
//