LOCUS       X02910                  3634 bp    DNA     linear   HUM 14-NOV-2006
DEFINITION  Human gene for tumor necrosis factor (TNF-alpha).
ACCESSION   X02910 X02159
VERSION     X02910.1
KEYWORDS    signal peptide; tumor necrosis factor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3634)
  AUTHORS   Nedwin,G.E., Naylor,S.L., Sakaguchi,A.Y., Smith,D.,
            Jarrett-Nedwin,J., Pennica,D., Goeddel,D.V. and  Gray,P.W.
  TITLE     Human lymphotoxin and tumor necrosis factor genes: structure,
            homology and chromosomal localization
  JOURNAL   Nucleic Acids Res. 13(17), 6361-6373(1985).
   PUBMED   2995927
REFERENCE   2  (bases 329 to 3634)
  AUTHORS   Shirai,T., Yamaguchi,H., Ito,H., Todd,C.W. and  Wallace,R.B.
  TITLE     Cloning and expression in Escherichia coli of the gene for human
            tumour necrosis factor
  JOURNAL   Nature 313(6005), 803-806(1985).
   PUBMED   3883195
REFERENCE   3
  AUTHORS   Pennica,D., Nedwin,G.E., Hayflick,J.S., Seeburg,P.H., Derynck,R.,
            Palladino,M.A., Kohr,W.J., Aggarwal,B.B. and  Goeddel,D.V.
  TITLE     Human tumour necrosis factor: precursor structure, expression and
            homology to lymphotoxin
  JOURNAL   Nature 312(5996), 724-729(1984).
   PUBMED   6392892
COMMENT     In the cDNA sequence from ref [3] the mature protein site starts
            also with Val at pos 1631
            Data kindly reviewed (18-FEB-1986) by A. Sakaguchi
FEATURES             Location/Qualifiers
     source          1..3634
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
     TATA_signal     590..595
     prim_transcript 615..3381
                     /note="put. primary transcript"
     exon            615..981
                     /number=1
     misc_difference 768
                     /replace="c"
                     /note="conflict"
                     /citation=[3]
     CDS             join(796..981,1589..1634,1822..1869,2171..2592)
                     /product="TNF-alpha"
                     /db_xref="GOA:P01375"
                     /db_xref="HGNC:HGNC:11892"
                     /db_xref="InterPro:IPR002959"
                     /db_xref="InterPro:IPR006052"
                     /db_xref="InterPro:IPR006053"
                     /db_xref="InterPro:IPR008064"
                     /db_xref="InterPro:IPR008983"
                     /db_xref="InterPro:IPR021184"
                     /db_xref="PDB:1A8M"
                     /db_xref="PDB:1TNF"
                     /db_xref="PDB:2AZ5"
                     /db_xref="PDB:2E7A"
                     /db_xref="PDB:2TUN"
                     /db_xref="PDB:2ZJC"
                     /db_xref="PDB:2ZPX"
                     /db_xref="PDB:3ALQ"
                     /db_xref="PDB:3IT8"
                     /db_xref="PDB:3L9J"
                     /db_xref="PDB:3WD5"
                     /db_xref="PDB:4G3Y"
                     /db_xref="PDB:4TSV"
                     /db_xref="PDB:5TSW"
                     /db_xref="UniProtKB/Swiss-Prot:P01375"
                     /protein_id="CAA26669.1"
                     /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGA
                     TTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQL
                     QWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIA
                     VSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYL
                     DFAESGQVYFGIIAL"
     sig_peptide     join(796..981,1589..1630)
                     /note="put. signal peptide (aa -76 to -1; aa -78  to -3 in
                     ref.[2])"
     intron          982..1588
                     /number=1
     misc_difference 1092
                     /replace=""
                     /note="conflict"
                     /citation=[2]
                     /citation=[3]
     exon            1589..1634
                     /number=2
     mat_peptide     join(1631..1634,1822..1869,2171..2589)
                     /product="TNF-alpha"
     intron          1635..1821
                     /number=2
     exon            1822..1869
                     /number=3
     misc_feature    1822..1823
                     /note="put. signal peptide (aa -1, ref. [2])"
     misc_feature    1824..1869
                     /note="TNF-alpha (aa 1-15, ref. 2)"
     intron          1870..2170
                     /number=3
     exon            2171..3381
                     /number=4
     misc_feature    2171..2589
                     /note="TNF-alpha (aa 18-157; aa 16-155 in ref.  [2])"
     misc_difference 2791
                     /replace="t"
                     /note="conflict"
                     /citation=[3]
     misc_difference 2882
                     /replace="a"
                     /note="conflict"
                     /citation=[2]
     misc_difference 3326
                     /replace="a"
                     /note="conflict"
                     /citation=[2]
     polyA_signal    3368..3373
     polyA_site      3381
BASE COUNT          906 a          959 c          975 g          794 t
ORIGIN
        1 gaattccggg tgatttcact cccggctgtc caggcttgtc ctgctacccc acccagcctt
       61 tcctgaggcc tcaagcctgc caccaagccc ccagctcctt ctccccgcag gacccaaaca
      121 caggcctcag gactcaacac agcttttccc tccaacccgt tttctctccc tcaacggact
      181 cagctttctg aagcccctcc cagttctagt tctatctttt tcctgcatcc tgtctggaag
      241 ttagaaggaa acagaccaca gacctggtcc ccaaaagaaa tggaggcaat aggttttgag
      301 gggcatgggg acggggttca gcctccaggg tcctacacac aaatcagtca gtggcccaga
      361 agacccccct cggaatcgga gcagggagga tggggagtgt gaggggtatc cttgatgctt
      421 gtgtgtcccc aactttccaa atccccgccc ccgcgatgga gaagaaaccg agacagaagg
      481 tgcagggccc actaccgctt cctccagatg agctcatggg tttctccacc aaggaagttt
      541 tccgctggtt gaatgattct ttccccgccc tcctctcgcc ccagggacat ataaaggcag
      601 ttgttggcac acccagccag cagacgctcc ctcagcaagg acagcagagg accagctaag
      661 agggagagaa gcaactacag accccccctg aaaacaaccc tcagacgcca catcccctga
      721 caagctgcca ggcaggttct cttcctctca catactgacc cacggcttca ccctctctcc
      781 cctggaaagg acaccatgag cactgaaagc atgatccggg acgtggagct ggccgaggag
      841 gcgctcccca agaagacagg ggggccccag ggctccaggc ggtgcttgtt cctcagcctc
      901 ttctccttcc tgatcgtggc aggcgccacc acgctcttct gcctgctgca ctttggagtg
      961 atcggccccc agagggaaga ggtgagtgcc tggccagcct tcatccactc tcccacccaa
     1021 ggggaaatga gagacgcaag agagggagag agatgggatg ggtgaaagat gtgcgctgat
     1081 agggagggat gagagagaaa aaaacatgga gaaagacggg gatgcagaaa gagatgtggc
     1141 aagagatggg gaagagagag agagaaagat ggagagacag gatgtctggc acatggaagg
     1201 tgctcactaa gtgtgtatgg agtgaatgaa tgaatgaatg aatgaacaag cagatatata
     1261 aataagatat ggagacagat gtggggtgtg agaagagaga tgggggaaga aacaagtgat
     1321 atgaataaag atggtgagac agaaagagcg ggaaatatga cagctaagga gagagatggg
     1381 ggagataagg agagaagaag atagggtgtc tggcacacag aagacactca gggaaagagc
     1441 tgttgaatgc tggaaggtga atacacagat gaatggagag agaaaaccag acacctcagg
     1501 gctaagagcg caggccagac aggcagccag ctgttcctcc tttaagggtg actccctcga
     1561 tgttaaccat tctccttctc cccaacagtt ccccagggac ctctctctaa tcagccctct
     1621 ggcccaggca gtcagtaagt gtctccaaac ctctttccta attctgggtt tgggtttggg
     1681 ggtagggtta gtaccggtat ggaagcagtg ggggaaattt aaagttttgg tcttggggga
     1741 ggatggatgg aggtgaaagt aggggggtat tttctaggaa gtttaagggt ctcagctttt
     1801 tcttttctct ctcctcttca ggatcatctt ctcgaacccc gagtgacaag cctgtagccc
     1861 atgttgtagg taagagctct gaggatgtgt cttggaactt ggagggctag gatttgggga
     1921 ttgaagcccg gctgatggta ggcagaactt ggagacaatg tgagaaggac tcgctgagct
     1981 caagggaagg gtggaggaac agcacaggcc ttagtgggat actcagaacg tcatggccag
     2041 gtgggatgtg ggatgacaga cagagaggac aggaaccgga tgtggggtgg gcagagctcg
     2101 agggccagga tgtggagagt gaaccgacat ggccacactg actctcctct ccctctctcc
     2161 ctccctccag caaaccctca agctgagggg cagctccagt ggctgaaccg ccgggccaat
     2221 gccctcctgg ccaatggcgt ggagctgaga gataaccagc tggtggtgcc atcagagggc
     2281 ctgtacctca tctactccca ggtcctcttc aagggccaag gctgcccctc cacccatgtg
     2341 ctcctcaccc acaccatcag ccgcatcgcc gtctcctacc agaccaaggt caacctcctc
     2401 tctgccatca agagcccctg ccagagggag accccagagg gggctgaggc caagccctgg
     2461 tatgagccca tctatctggg aggggtcttc cagctggaga agggtgaccg actcagcgct
     2521 gagatcaatc ggcccgacta tctcgacttt gccgagtctg ggcaggtcta ctttgggatc
     2581 attgccctgt gaggaggacg aacatccaac cttcccaaac gcctcccctg ccccaatccc
     2641 tttattaccc cctccttcag acaccctcaa cctcttctgg ctcaaaaaga gaattggggg
     2701 cttagggtcg gaacccaagc ttagaacttt aagcaacaag accaccactt cgaaacctgg
     2761 gattcaggaa tgtgtggcct gcacagtgaa gtgctggcaa ccactaagaa ttcaaactgg
     2821 ggcctccaga actcactggg gcctacagct ttgatccctg acatctggaa tctggagacc
     2881 agggagcctt tggttctggc cagaatgctg caggacttga gaagacctca cctagaaatt
     2941 gacacaagtg gaccttaggc cttcctctct ccagatgttt ccagacttcc ttgagacacg
     3001 gagcccagcc ctccccatgg agccagctcc ctctatttat gtttgcactt gtgattattt
     3061 attatttatt tattatttat ttatttacag atgaatgtat ttatttggga gaccggggta
     3121 tcctggggga cccaatgtag gagctgcctt ggctcagaca tgttttccgt gaaaacggag
     3181 ctgaacaata ggctgttccc atgtagcccc ctggcctctg tgccttcttt tgattatgtt
     3241 ttttaaaata tttatctgat taagttgtct aaacaatgct gatttggtga ccaactgtca
     3301 ctcattgctg agcctctgct ccccagggga gttgtgtctg taatcgccct actattcagt
     3361 ggcgagaaat aaagtttgct tagaaaagaa acatggtctc cttcttggaa ttaattctgc
     3421 atctgcctct tcttgtgggt gggaagaagc tccctaagtc ctctctccac aggctttaag
     3481 atccctcgga cccagtccca tccttagact cctagggccc tggagaccct acataaacaa
     3541 agcccaacag aatattcccc atcccccagg aaacaagagc ctgaacctaa ttacctctcc
     3601 ctcagggcat gggaatttcc aactctggga attc
//