LOCUS       X01057                  2335 bp    mRNA    linear   HUM 22-JUL-1993
DEFINITION  Human mRNA for interleukin-2 receptor.
ACCESSION   X01057 X01058 X01402
VERSION     X01057.1
KEYWORDS    alternate splicing; interleukin receptor; signal peptide.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2335)
  AUTHORS   Leonard,W.J., Depper,J.M., Crabtree,G.R., Rudikoff,S., Pumphrey,J.,
            Robb,R.J., Kroenke,M., Svetlik,P.B., Peffer,N.J., Waldmann,T.A. and
             Greene,W.C.
  TITLE     Molecular cloning and expression of cDNAs for the human
            interleukin-2 receptor
  JOURNAL   Nature 311(5987), 626-631(1984).
   PUBMED   6090948
REFERENCE   2  (bases 1 to 1309)
  AUTHORS   Nikaido,T., Shimizu,A., Ishida,N., Sabe,H., Teshigawara,K.,
            Maeda,M., Uchiyama,T., Yodoi,J. and  Honjo,T.
  TITLE     Molecular cloning of cDNA encoding human interleukin-2 receptor
  JOURNAL   Nature 311(5987), 631-635(1984).
   PUBMED   6090949
REFERENCE   3  (bases 1 to 862)
  AUTHORS   Cosman,D., Cerretti,D.P., Larsen,A., Park,L., March,C., Dower,S.,
            Gillis,S. and  Urdal,D.
  TITLE     Cloning, sequence and expression of human interleukin-2 receptor
  JOURNAL   Nature 312(5996), 768-771(1984).
   PUBMED   6096720
REFERENCE   4
  AUTHORS   Behn-Krappa,A. and  Doerfler,W.
  TITLE     The state of DNA methylation in the promoter and exon 1 regions of
            the human gene for the interleukin-2 receptor alpha chain (IL-2R
            alpha) in various cell types
  JOURNAL   Hum. Mol. Genet. 2(7), 993-999(1993).
   PUBMED   8364583
FEATURES             Location/Qualifiers
     source          1..2335
                     /db_xref="H-InvDB:HIT000320885"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     mRNA            join(<1..497,764..>2335)
                     /note="put. fragment of 3,3 Kb mRNA"
     CDS             181..999
                     /product="interleukin-2 receptor"
                     /db_xref="GOA:P01589"
                     /db_xref="H-InvDB:HIT000320885.14"
                     /db_xref="HGNC:HGNC:6008"
                     /db_xref="InterPro:IPR000436"
                     /db_xref="InterPro:IPR015486"
                     /db_xref="PDB:1ILM"
                     /db_xref="PDB:1ILN"
                     /db_xref="PDB:1Z92"
                     /db_xref="PDB:2B5I"
                     /db_xref="PDB:2ERJ"
                     /db_xref="PDB:3IU3"
                     /db_xref="PDB:3NFP"
                     /db_xref="UniProtKB/Swiss-Prot:P01589"
                     /protein_id="CAA25525.1"
                     /translation="MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEG
                     TMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQK
                     ERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALH
                     RGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTT
                     DFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI"
     sig_peptide     181..243
                     /note="signal peptide (aa -21 to -1)"
     mat_peptide     244..996
                     /product="interleukin-2 receptor"
     variation       895..895
                     /note="existing variant with T changed to C"
     polyA_signal    1523..1528
     unsure          1604..1604
                     /note="T maybe C"
BASE COUNT          690 a          592 c          573 g          480 t
ORIGIN
        1 gaattccccc cccccccccc cgagagactg gatggaccca caagggtgac agcccaggcg
       61 gaccgatctt cccatcccac atcctccggc gcgatgccaa aaagaggctg acggcaactg
      121 ggccttctgc agagaaagac ctccgcttca ctgccccggc tggtcccaag ggtcaggaag
      181 atggattcat acctgctgat gtggggactg ctcacgttca tcatggtgcc tggctgccag
      241 gcagagctct gtgacgatga cccgccagag atcccacacg ccacattcaa agccatggcc
      301 tacaaggaag gaaccatgtt gaactgtgaa tgcaagagag gtttccgcag aataaaaagc
      361 gggtcactct atatgctctg tacaggaaac tctagccact cgtcctggga caaccaatgt
      421 caatgcacaa gctctgccac tcggaacaca acgaaacaag tgacacctca acctgaagaa
      481 cagaaagaaa ggaaaaccac agaaatgcaa agtccaatgc agccagtgga ccaagcgagc
      541 cttccaggtc actgcaggga acctccacca tgggaaaatg aagccacaga gagaatttat
      601 catttcgtgg tggggcagat ggtttattat cagtgcgtcc agggatacag ggctctacac
      661 agaggtcctg ctgagagcgt ctgcaaaatg acccacggga agacaaggtg gacccagccc
      721 cagctcatat gcacaggtga aatggagacc agtcagtttc caggtgaaga gaagcctcag
      781 gcaagccccg aaggccgtcc tgagagtgag acttcctgcc tcgtcacaac aacagatttt
      841 caaatacaga cagaaatggc tgcaaccatg gagacgtcca tatttacaac agagtaccag
      901 gtagcagtgg ccggctgtgt tttcctgctg atcagcgtcc tcctcctgag tgggctcacc
      961 tggcagcgga gacagaggaa gagtagaaga acaatctaga aaaccaaaag aacaagaatt
     1021 tcttggtaag aagccgggaa cagacaacag aagtcatgaa gcccaagtga aatcaaaggt
     1081 gctaaatggt cgcccaggag acatccgttg tgcttgcctg cgttttggaa gctctgaagt
     1141 cacatcacag gacacggggc agtggcaacc ttgtctctat gccagctcag tcccatcaga
     1201 gagcgagcgc tacccacttc taaatagcaa tttcgccgtt gaagaggaag ggcaaaacca
     1261 ctagaactct ccatcttatt ttcatgtata tgtgttcatt aaagcatgaa tggtatggaa
     1321 ctctctccac cctatatgta gtataaagaa aagtaggttt acattcatct cattccaact
     1381 tcccagttca ggagtcccaa ggaaagcccc agcactaacg taaatacaca acacacacac
     1441 tctaccctat acaactggac attgtctgcg tggttccttt ctcagccgct tctgactgct
     1501 gattctcccg ttcacgttgc ctaataaaca tccttcaaga actctgggct gctacccaga
     1561 aatcatttta cccttggctc aatcctctaa gctaaccccc ttctactgag ccttcagtct
     1621 tgaatttcta aaaaacagag gccatggcag aataatcttt gggtaacttc aaaacggggc
     1681 agccaaaccc atgaggcaat gtcaggaaca gaaggatgaa tgaggtccca ggcagagaat
     1741 catacttagc aaagttttac ctgtgcgtta ctaattggcc tctttaagag ttagtttctt
     1801 tgggattgct atgaatgata ccctgaattt ggcctgcact aatttgatgt ttacaggtgg
     1861 acacacaagg tgcaaatcaa tgcgtacgtt tcctgagaag tgtctaaaaa caccaaaaag
     1921 ggatccgtac attcaatgtt tatgcaagga aggaaagaaa gaaggaagtg aagagggaga
     1981 agggatggag gtcacactgg tagaacgtaa ccacggaaaa gagcgcatca ggcctggcac
     2041 ggtggctcag gcctataacc ccagctccct aggagaccaa ggcgggagca tctcttgagg
     2101 ccaggagttt gagaccagcc tgggcagcat agcaagacac atccctacaa aaaattagaa
     2161 attggctgga tgtggtggca tacgcctgta gtcctagcca ctcaggaggc tgaggcagga
     2221 ggattgcttg agcccaggag ttcgaggctg cagtcagtca tgatggcacc actgcactcc
     2281 agcctgggca acagagcaag atcctgtctt taaggaaaaa aagacaaggg aattc
//