LOCUS X00955 467 bp mRNA linear HUM 07-OCT-2008 DEFINITION Human mRNA for apolipoprotein AII precursor. ACCESSION X00955 K01686 K02216 X00569 X00927 VERSION X00955.1 KEYWORDS apolipoprotein; signal peptide. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 467) AUTHORS Knott T.J., Priestley L.M., Urdea M.S., Scott J. TITLE Isolation and characterisation of a cDNA encoding the precursor for human apolipoprotein AII JOURNAL Biochem. Biophys. Res. Commun. 120(3), 734-740(1984). PUBMED 6428397 REFERENCE 2 AUTHORS Brewer H.M., Lux S.E., Ronan R., John K.M. TITLE Amino acid sequence of human apoLp-Gln-II (apoA-II), an apolipoprotein isolated from the high-density lipoprotein complex JOURNAL Proc. Natl. Acad. Sci. U.S.A. 69(5), 1304-1308(1972). PUBMED 4338591 REFERENCE 3 AUTHORS Lackner K.J., Law S.W., Brewer H.B.Jr. TITLE Human apolipoprotein A-II: complete nucleic acid sequence of preproapo A-II JOURNAL FEBS Lett. 175(1), 159-164(1984). PUBMED 6090207 REFERENCE 4 AUTHORS Moore M.N., Kao F.T., Tsao Y.K., Chan L. TITLE Human apolipoprotein A-II: nucleotide sequence of a cloned cDNA, and localization of its structural gene on human chromosome 1 JOURNAL Biochem. Biophys. Res. Commun. 123(1), 1-7(1984). PUBMED 6089788 REFERENCE 5 AUTHORS Sharpe C.R., Sidoli A., Shelley C.S., Lucero M.A., Shoulders C.C., Baralle F.E. TITLE Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance JOURNAL Nucleic Acids Res. 12(9), 3917-3932(1984). PUBMED 6328445 FEATURES Location/Qualifiers source 1..467 /db_xref="H-InvDB:HIT000320883" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 52..354 /note="prepro-apo AII" /db_xref="GOA:P02652" /db_xref="H-InvDB:HIT000320883.13" /db_xref="HGNC:HGNC:601" /db_xref="InterPro:IPR006801" /db_xref="InterPro:IPR036172" /db_xref="UniProtKB/Swiss-Prot:P02652" /protein_id="CAA25467.1" /translation="MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDY GKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ" sig_peptide 52..105 /note="signal peptide" misc_feature 105..106 /note="signal peptidase cleavage site" misc_feature 106..120 /note="propeptide" mat_peptide 121..351 /note="apo AII" misc_feature 448..453 /note="polyadenylation signal" polyA_site 467..467 /note="polyadenylation site" BASE COUNT 119 a 133 c 114 g 101 t ORIGIN 1 atacccgagg acagagatgt tggttaggcc gccctcccca ctgttaccaa catgaagctg 61 ctcgcagcaa ctgtgctact cctcaccatc tgcagccttg aaggagcttt ggttcggaga 121 caggcaaagg agccatgtgt ggagagcctg gtttctcagt acttccagac cgtgactgac 181 tatggcaagg acctgatgga gaaggtcaag agcccagagc ttcaggccga ggccaagtct 241 tactttgaaa agtcaaagga gcagctgaca cccctgatca agaaggctgg aacggaactg 301 gttaacttct tgagctattt cgtggaactt ggaacacagc ctgccaccca gtgaagtgtc 361 cagcaccatt gtcttccaac cccagctggc ctctagaaca cccactggcc agtcctagag 421 ctcctgtccc tacccactct ttgctacaat aaatgctgaa tgaatcc //