LOCUS       X00694                  1550 bp    DNA     linear   BCT 18-APR-2005
DEFINITION  E.coli Tn10 tetR gene coding for tetR repressor.
ACCESSION   X00694
VERSION     X00694.1
KEYWORDS    repressor; tetracycline resistance; transposon.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 1550)
  AUTHORS   Postle K., Nguyen T.T., Bertrand K.P.
  TITLE     Nucleotide sequence of the repressor gene of the TN10 tetracycline
            resistance determinant
  JOURNAL   Nucleic Acids Res. 12(12), 4849-4863(1984).
   PUBMED   6330687
COMMENT     Data kindly reviewed (06-NOV-1985) by K.P. Bertrand
FEATURES             Location/Qualifiers
     source          1..1550
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
     misc_feature    7..7
                     /note="tetR mRNA start site"
     regulatory      12..17
                     /note="Shine-Dalgarno sequence"
                     /regulatory_class="ribosome_binding_site"
     CDS             25..648
                     /transl_table=11
                     /note="tetR repressor"
                     /db_xref="GOA:P04483"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR003012"
                     /db_xref="InterPro:IPR004111"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR023772"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="InterPro:IPR039419"
                     /db_xref="PDB:2NS7"
                     /db_xref="PDB:2NS8"
                     /db_xref="PDB:2VKV"
                     /db_xref="PDB:2XGC"
                     /db_xref="PDB:2XGD"
                     /db_xref="PDB:2XGE"
                     /db_xref="PDB:3FK6"
                     /db_xref="PDB:3FK7"
                     /db_xref="PDB:3ZQF"
                     /db_xref="PDB:3ZQG"
                     /db_xref="PDB:3ZQH"
                     /db_xref="PDB:3ZQI"
                     /db_xref="PDB:4AC0"
                     /db_xref="UniProtKB/Swiss-Prot:P04483"
                     /protein_id="CAA25291.1"
                     /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH
                     VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLG
                     TRPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERET
                     PTTDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS"
BASE COUNT          474 a          326 c          308 g          442 t
ORIGIN      
        1 gtcaacaaaa attaggaatt aatgatgtct agattagata aaagtaaagt gattaacagc
       61 gcattagagc tgcttaatga ggtcggaatc gaaggtttaa caacccgtaa actcgcccag
      121 aagctaggtg tagagcagcc tacattgtat tggcatgtaa aaaataagcg ggctttgctc
      181 gacgccttag ccattgagat gttagatagg caccatactc acttttgccc tttagaaggg
      241 gaaagctggc aagatttttt acgtaataac gctaaaagtt ttagatgtgc tttactaagt
      301 catcgcgatg gagcaaaagt acatttaggt acacggccta cagaaaaaca gtatgaaact
      361 ctcgaaaatc aattagcctt tttatgccaa caaggttttt cactagagaa tgcattatat
      421 gcactcagcg ctgtggggca ttttacttta ggttgcgtat tggaagatca agagcatcaa
      481 gtcgctaaag aagaaaggga aacacctact actgatagta tgccgccatt attacgacaa
      541 gctatcgaat tatttgatca ccaaggtgca gagccagcct tcttattcgg ccttgaattg
      601 atcatatgcg gattagaaaa acaacttaaa tgtgaaagtg ggtcttaaaa gcagcataac
      661 ctttttccgt gatggtaact tcacggtaac caagatgtcg agttaaccac cctttagatt
      721 cataaagcga aaataatgcg gctccaacgt acccacctaa atggaaacgg cgttcactcc
      781 aatctaaaca cgcacaacag attttacgtg aatgtttgga aggaacgtca attcccattt
      841 catgaaaata ttgaatacca cttaatgtga tcattgaacc attttcagtg atccattgct
      901 gttgacaaag ggaatcatag atcttaacgg caacttcgcc agctaaatga tcatatagca
      961 agtacgtgct tttcgtaaat gcactggcgt ggaaactttg gcatgtacgc catggtttaa
     1021 ggagatcccc atcatacttt ccatcaattc agcaatatct tttcctgcta gccgaaaata
     1081 acgatgcttg ccttgagcta ctactgtgat tagctggcaa tctaataatt tagataaatg
     1141 actgctcgcc gttgaagctg atatattcgc cacagaactt agctcagtgg ccgtccaagc
     1201 tcgcccatcc atcaaagcac tgagtatttt aactcgtgaa atgtcagaca tgagccccct
     1261 atcgcggcta ttgaggactc aaaggtaacc tcttttcgta ttaaattagc catcgcaagt
     1321 tcactttatt gcccaaggga gcgtaacaga tgcagccata ctatcattgt ccgttattaa
     1381 tatcagttgg ttagcatggt cactgtattg cactaaaata ttaatgttat tctccgccaa
     1441 tactcgtgct atttcgccaa gttcccccgg tttttcctgt tttaacttac gaattaatgg
     1501 tgtccggatc gcaagtacta acagtccagc ttgctctagc gctattttag
//