LOCUS       HSU81984                2818 bp    mRNA    linear   HUM 28-JAN-1997
DEFINITION  Human endothelial PAS domain protein 1 (EPAS1) mRNA, complete cds.
ACCESSION   U81984
VERSION     U81984.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2818)
  AUTHORS   Tian,H., McKnight,S.L. and Russell,D.W.
  TITLE     Endothelial PAS domain protein 1 (EPAS1), a transcription factor
            selectively expressed in endothelial cells
  JOURNAL   Genes Dev. 11 (1), 72-82 (1997)
   PUBMED   9000051
REFERENCE   2  (bases 1 to 2818)
  AUTHORS   Tian,H., McKnight,S.L. and Russell,D.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-1996) Molecular Genetics, University of Texas
            Southwestern Medical Center, 5323 Harry Hines Blvd., Dallas, TX
            75235, USA
FEATURES             Location/Qualifiers
     source          1..2818
                     /db_xref="H-InvDB:HIT000221735"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..2818
                     /gene="EPAS1"
     CDS             150..2762
                     /gene="EPAS1"
                     /note="bHLH-PAS"
                     /codon_start=1
                     /product="endothelial PAS domain protein 1"
                     /protein_id="AAB41495.1"
                     /db_xref="GI:1805268"
                     /translation="MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLP
                     HSVSSHLDKASIMRLEISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVV
                     TQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSK
                     DMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPL
                     LSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRS
                     AYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQP
                     QCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTK
                     LKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSE
                     AGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEVIEKLFAMD
                     TEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSA
                     MTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQA
                     STPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTR
                     SAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRM
                     KNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSR
                     FPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTL
                     LQGGDLLRALDQAT"
BASE COUNT          669 a          882 c          764 g          503 t
ORIGIN      
        1 cctgactgcg cggggcgctc gggacctgcg cgcacctcgg accttcacca cccgcccggg
       61 ccgcggggag cggacgaggg ccacagcccc ccacccgcca gggagcccag gtgctcggcg
      121 tctgaacgtc tcaaagggcc acagcgacaa tgacagctga caaggagaag aaaaggagta
      181 gctcggagag gaggaaggag aagtcccggg atgctgcgcg gtgccggcgg agcaaggaga
      241 cggaggtgtt ctatgagctg gcccatgagc tgcctctgcc ccacagtgtg agctcccatc
      301 tggacaaggc ctccatcatg cgactggaaa tcagcttcct gcgaacacac aagctcctct
      361 cctcagtttg ctctgaaaac gagtccgaag ccgaagctga ccagcagatg gacaacttgt
      421 acctgaaagc cttggagggt ttcattgccg tggtgaccca agatggcgac atgatctttc
      481 tgtcagaaaa catcagcaag ttcatgggac ttacacaggt ggagctaaca ggacatagta
      541 tctttgactt cactcatccc tgcgaccatg aggagattcg tgagaacctg agtctcaaaa
      601 atggctctgg ttttgggaaa aaaagcaaag acatgtccac agagcgggac ttcttcatga
      661 ggatgaagtg cacggtcacc aacagaggcc gtactgtcaa cctcaagtca gccacctgga
      721 aggtcttgca ctgcacgggc caggtgaaag tctacaacaa ctgccctcct cacaatagtc
      781 tgtgtggcta caaggagccc ctgctgtcct gcctcatcat catgtgtgaa ccaatccagc
      841 acccatccca catggacatc cccctggata gcaagacctt cctgagccgc cacagcatgg
      901 acatgaagtt cacctactgt gatgacagaa tcacagaact gattggttac caccctgagg
      961 agctgcttgg ccgctcagcc tatgaattct accatgcgct agactccgag aacatgacca
     1021 agagtcacca gaacttgtgc accaagggtc aggtagtaag tggccagtac cggatgctcg
     1081 caaagcatgg gggctacgtg tggctggaga cccaggggac ggtcatctac aaccctcgca
     1141 acctgcagcc ccagtgcatc atgtgtgtca actacgtcct gagtgagatt gagaagaatg
     1201 acgtggtgtt ctccatggac cagactgaat ccctgttcaa gccccacctg atggccatga
     1261 acagcatctt tgatagcagt ggcaaggggg ctgtgtctga gaagagtaac ttcctattca
     1321 ccaagctaaa ggaggagccc gaggagctgg cccagctggc tcccacccca ggagacgcca
     1381 tcatctctct ggatttcggg aatcagaact tcgaggagtc ctcagcctat ggcaaggcca
     1441 tcctgccccc gagccagcca tgggccacgg agttgaggag ccacagcacc cagagcgagg
     1501 ctgggagcct gcctgccttc accgtgcccc aggcagctgc cccgggcagc accaccccca
     1561 gtgccaccag cagcagcagc agctgctcca cgcccaatag ccctgaagac tattacacat
     1621 ctttggataa cgacctgaag attgaagtga ttgagaagct cttcgccatg gacacagagg
     1681 ccaaggacca atgcagtacc cagacggatt tcaatgagct ggacttggag acactggcac
     1741 cctatatccc catggacggg gaagacttcc agctaagccc catctgcccc gaggagcggc
     1801 tcttggcgga gaacccacag tccacccccc agcactgctt cagtgccatg acaaacatct
     1861 tccagccact ggcccctgta gccccgcaca gtcccttcct cctggacaag tttcagcagc
     1921 agctggagag caagaagaca gagcccgagc accggcccat gtcctccatc ttctttgatg
     1981 ccggaagcaa agcatccctg ccaccgtgct gtggccaggc cagcacccct ctctcttcca
     2041 tggggggcag atccaatacc cagtggcccc cagatccacc attacatttt gggcccacaa
     2101 agtgggccgt cggggatcag cgcacagagt tcttgggagc agcgccgttg gggccccctg
     2161 tctctccacc ccatgtctcc accttcaaga caaggtctgc aaagggtttt ggggctcgag
     2221 gcccagacgt gctgagtccg gccatggtag ccctctccaa caagctgaag ctgaagcgac
     2281 agctggagta tgaagagcaa gccttccagg acctgagcgg gggggaccca cctggtggca
     2341 gcacctcaca tttgatgtgg aaacggatga agaacctcag gggtgggagc tgccctttga
     2401 tgccggacaa gccactgagc gcaaatgtac ccaatgataa gttcacccaa aaccccatga
     2461 ggggcctggg ccatcccctg agacatctgc cgctgccaca gcctccatct gccatcagtc
     2521 ccggggagaa cagcaagagc aggttccccc cacagtgcta cgccacccag taccaggact
     2581 acagcctgtc gtcagcccac aaggtgtcag gcatggcaag ccggctgctc gggccctcat
     2641 ttgagtccta cctgctgccc gaactgacca gatatgactg tgaggtgaac gtgcccgtgc
     2701 tgggaagctc cacgctcctg caaggagggg acctcctcag agccctggac caggccacct
     2761 gagccaggcc ttctacctgg gcagcacctc tgccgacgcc gtcccaccag cttcaccc
//