LOCUS       HSU78876                2348 bp    mRNA    linear   HUM 01-FEB-1997
DEFINITION  Human MEK kinase 3 mRNA, complete cds.
ACCESSION   U78876
VERSION     U78876.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2348)
  AUTHORS   Ellinger-Ziegelbauer,H.C., Brown,K., Kelly,K. and Siebenlist,U.
  TITLE     Direct activation of the SAPK and ERK pathways by an inducible
            MEKK3 derivative
  JOURNAL   J. Biol. Chem. (1997) In press
REFERENCE   2  (bases 1 to 2348)
  AUTHORS   Ellinger-Ziegelbauer,H.C., Brown,K., Kelly,K. and Siebenlist,U.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-NOV-1996) Laboratory of Immunoregulation, NIAID,
            National Institutes of Health, 9000 Rockville Pike, Bethesda, MD
            20892-1876, USA
FEATURES             Location/Qualifiers
     source          1..2348
                     /db_xref="H-InvDB:HIT000221454"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             84..1964
                     /function="SAPK/ERK pathway regulator"
                     /note="hMEKK3"
                     /codon_start=1
                     /product="MEK kinase 3"
                     /protein_id="AAB41729.1"
                     /db_xref="GI:1813646"
                     /translation="MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSD
                     VRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDK
                     AIDILDRSSSMKSLRILLLSQDRNHNSSSPHSEVSRQVRIKASQSAGDINTIYQPPEP
                     RSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLS
                     SAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYP
                     RRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGR
                     LRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQ
                     VQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGS
                     VKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDF
                     GASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPP
                     WAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQL
                     MY"
BASE COUNT          557 a          670 c          682 g          439 t
ORIGIN      
        1 ccgccgcccg ggcccccggc atgcagcccc ggctgcggag gtgacactca cggaccttag
       61 ccaccgccgc cgccatcgcc accatggacg aacaggaggc attgaactca atcatgaacg
      121 atctggtggc cctccagatg aaccgacgtc accggatgcc tggatatgag accatgaaga
      181 acaaagacac aggtcactca aataggcaga gtgacgtcag aatcaagttc gagcacaacg
      241 gggagaggcg aattatagcg ttcagccggc ctgtgaaata tgaagatgtg gagcacaagg
      301 tgacaacagt atttggacaa cctcttgatc tacattacat gaacaatgag ctctccatcc
      361 tgctgaaaaa ccaagatgat cttgataaag caattgacat tttagataga agctcaagca
      421 tgaaaagcct taggatattg ctgttgtccc aggacagaaa ccataacagt tcctctcccc
      481 actctgaggt gtccagacag gtgcggatca aggcttccca gtccgcaggg gatataaata
      541 ctatctacca gccccccgag cccagaagca ggcacctctc tgtcagctcc cagaaccctg
      601 gccgaagctc acctccccct ggctatgttc ctgagcggca gcagcacatt gcccggcagg
      661 ggtcctacac cagcatcaac agtgaggggg agttcatccc agagaccagc gagcagtgca
      721 tgctggatcc cctgagcagt gcagaaaatt ccttgtctgg aagctgccaa tccttggaca
      781 ggtcagcaga cagcccatcc ttccggaaat cacgaatgtc ccgtgcccag agcttccctg
      841 acaacagaca ggaatactca gatcgggaaa ctcagcttta tgacaaaggg gtcaaaggtg
      901 gaacctaccc ccggcgctac cacgtgtctg tgcaccacaa ggactacagt gatggcagaa
      961 gaacatttcc ccgaatacgg cgtcatcaag gcaacttgtt caccctggtg ccctccagcc
     1021 gctccctgag cacaaatggc gagaacatgg gtctggctgt gcaatacctg gacccccgtg
     1081 ggcgcctgcg gagtgcggac agcgagaatg ccctctctgt gcaggagagg aatgtgccaa
     1141 ccaagtctcc cagtgccccc atcaactggc gccggggaaa gctcctgggc cagggtgcct
     1201 tcggcagggt ctatttgtgc tatgacgtgg acacgggacg tgaacttgct tccaagcagg
     1261 tccaatttga tccagacagt cctgagacaa gcaaggaggt gagtgctctg gagtgcgaga
     1321 tccagttgct aaagaacttg cagcatgagc gcatcgtgca gtactatggc tgtctgcggg
     1381 accgcgctga gaagaccctg accatcttca tggagtacat gccagggggc tcggtgaaag
     1441 accagttgaa ggcttacggt gctctgacag agagcgtgac ccgaaagtac acgcggcaga
     1501 tcctggaggg catgtcctac ctgcacagca acatgattgt tcaccgggac attaagggag
     1561 ccaacatcct ccgagactct gctgggaatg taaagctggg ggactttggg gccagcaaac
     1621 gcctgcagac gatctgtatg tcggggacgg gcatgcgctc cgtcactggc acaccctact
     1681 ggatgagccc tgaggtgatc agcggcgagg gctatggaag gaaagcagac gtgtggagcc
     1741 tgggctgcac tgtggtggag atgctgacag agaaaccacc gtgggcagag tatgaagcta
     1801 tggccgccat cttcaagatt gccacccagc ccaccaatcc tcagctgccc tcccacatct
     1861 ctgaacatgg ccgggacttc ctgaggcgca tttttgtgga ggctcgccag agaccttcag
     1921 ctgaggagct gctcacacac cactttgcac agctcatgta ctgagctctc acggccacac
     1981 agctgccggt cgccctttgc tgcatggcag ggggctgctg ctgggctcag tgaagttgct
     2041 gcttctccca ggcaaggctg tggaccatgg agtggcagcc cagccagcgt cggtctgtgc
     2101 cccttccgcc actggggctc agagccgggg tggggtggct gcagcctcag gactgggagc
     2161 ccccagcctg tcagatccag gagctccagt gtcctgagct cagcgtggag gggtaggggc
     2221 tgggaacagt gtgcaaggca gccgtgggcc ccaccctcgg ggatgtgtcc tgacactgca
     2281 attggcaccg aagcccagag ggtctggggg cacaagactg acgccagggt atgaagagtg
     2341 ttattttc
//