LOCUS       HSU76308                8239 bp    mRNA    linear   HUM 09-JAN-1997
DEFINITION  Human protein kinase ATR mRNA, complete cds.
ACCESSION   U76308
VERSION     U76308.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 8239)
  AUTHORS   Bentley,N.J., Holtzman,D.A., Flaggs,G., Keegan,K.S., DeMaggio,A.,
            Ford,J.C., Hoekstra,M. and Carr,A.M.
  TITLE     The Schizosaccharomyces pombe rad3 checkpoint gene
  JOURNAL   EMBO J. 15 (23), 6641-6651 (1996)
   PUBMED   8978690
REFERENCE   2  (bases 1 to 8239)
  AUTHORS   Bentley,N.J., Holtzman,D.A., Flaggs,G., Keegan,K.S., DeMaggio,A.,
            Ford,J.C., Hoekstra,M. and Carr,A.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-1996) MRC Cell Mutation Unit, Sussex University,
            Falmer, Brighton BN1 9RR, UK
FEATURES             Location/Qualifiers
     source          1..8239
                     /db_xref="H-InvDB:HIT000221284"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3q22-3q23"
     CDS             80..8014
                     /note="large lipid kinase like family, similar to ATM gene
                     and yeast checkpoint genes S. pombe rad3 and S. cerevisiae
                     MEC1"
                     /codon_start=1
                     /product="protein kinase ATR"
                     /protein_id="AAC50929.1"
                     /db_xref="GI:1666240"
                     /translation="MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRI
                     LTDVNVVAVELVKKTDSQPTSVMLLDFIQHIMKSSPLMFVNVSGSHERKGSCIEFSNW
                     IITRLLRIAATPSCHLLHKKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLH
                     RRNVMGHAVEWPVVMSRFLSQLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIA
                     IVFFRRQELLLWQIGCVLLEYGSPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLEL
                     LKHLVEMDTDQLKLYEEPLSKLIKTLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVL
                     MRLKSDLLKAALCHLLQYFLKFVPAGYESALQVRKVYVRNICKALLDVLGIEVDAEYL
                     LGPLYAALKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLNPSKRAPKQTEE
                     IKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQLTALCTVHCS
                     HQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKLDLEATIDKV
                     VKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFAANLLTLSCRI
                     SDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWALQSSHEVIRASCVSGFFILLQQQ
                     NSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHGMFYLTSSLTEPFSEHGHVDL
                     FCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKLAFIDNLHHLCKHLDFRED
                     ETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDGFIKELFVLRMKEAYTH
                     AQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKSASVSGAAYTEIRAL
                     VAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVRKQDVAHQREMAL
                     NTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQLNVNRREILI
                     NNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELLLRIGEHYQ
                     QVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLSSSVGIE
                     DKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFVRCLD
                     HACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPELK
                     KIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
                     YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQG
                     KDFTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETN
                     GPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASW
                     AGYLITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEI
                     MAVLKHDDQHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSN
                     RNKVDSMVSTVDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQN
                     IQEHLGFLQKLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAI
                     QLEPDQIIHYHGVVKSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQW
                     DLVENYLAADGKSTTWSVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERG
                     SYQRGYEYIVRLHMLCELEHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPI
                     LALRRALLSLNKRPDYNEMVGECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVE
                     RAKWLWSKGDVHQALIVLQKGVELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANF
                     ESNAIMKKYKDVTACLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGR
                     SLQYGNQFIYQSMPRMLTLWLDYGTKAYEWEKAGRSDRVQMRNDLGKINKVITEHTNY
                     LAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMR
                     VNRCKEILNKAIHMKKSLEKFVGDATRLTDKLLELCNKPVDGSSSTLSMSTHFKMLKK
                     LVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIAGFDDMVEILASL
                     QKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRRELHIRT
                     YAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELRQCMLPKSAALSEKLK
                     VFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGEN
                     ILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEV
                     TMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIE
                     QRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM"
BASE COUNT         2555 a         1540 c         1730 g         2414 t
ORIGIN      
        1 gcgctcttcc ggcagcggta cgtttggaga cgccgggaac ccgcgttggc gtggttgact
       61 agtgcctcgc agcctcagca tgggggaaca tggcctggag ctggcttcca tgatccccgc
      121 cctgcgggag ctgggcagtg ccacaccaga ggaatataat acagttgtac agaagccaag
      181 acaaattctg tgtcaattca ttgaccggat acttacagat gtaaatgttg ttgctgtaga
      241 acttgtaaag aaaactgact ctcagccaac ctccgtgatg ttgcttgatt tcatccagca
      301 tatcatgaaa tcctccccac ttatgtttgt aaatgtgagt ggaagccatg agcgcaaagg
      361 cagttgtatt gaattcagta attggatcat aacgagactt ctgcggattg cagcaactcc
      421 ctcctgtcat ttgttacaca agaaaatctg tgaagtcatc tgttcattat tatttctttt
      481 taaaagcaag agtcctgcta tttttggggt actcacaaaa gaattattac aactttttga
      541 agacttggtt tacctccata gaagaaatgt gatgggtcat gctgtggaat ggccagtggt
      601 catgagccga tttttaagtc aattagatga acacatggga tatttacaat cagctccttt
      661 gcagttgatg agtatgcaaa atttagaatt tattgaagtc actttattaa tggttcttac
      721 tcgtattatt gcaattgtgt tttttagaag gcaagaactc ttactttggc agataggttg
      781 tgttctgcta gagtatggta gtccaaaaat taaatcccta gcaattagct ttttaacaga
      841 actttttcag cttggaggac taccagcaca accagctagc acttttttca gctcattttt
      901 ggaattatta aaacaccttg tagaaatgga tactgaccaa ttgaaactct atgaagagcc
      961 attatcaaag ctgataaaga cactatttcc ctttgaagca gaagcttata gaaatattga
     1021 acctgtctat ttaaatatgc tgctggaaaa actctgtgtc atgtttgaag acggtgtgct
     1081 catgcggctt aagtctgatt tgctaaaagc agctttgtgc catttactgc agtatttcct
     1141 taaatttgtg ccagctgggt atgaatctgc tttacaagtc aggaaggtct atgtgagaaa
     1201 tatttgtaaa gctcttttgg atgtgcttgg aattgaggta gatgcagagt acttgttggg
     1261 cccactttat gcagctttga aaatggaaag tatggaaatc attgaggaga ttcaatgcca
     1321 aactcaacag gaaaacctca gcagtaatag tgatggaata tcacccaaaa ggcgtcgtct
     1381 cagctcgtct ctaaaccctt ctaaaagagc accaaaacag actgaggaaa ttaaacatgt
     1441 ggacatgaac caaaagagca tattatggag tgcactgaaa cagaaagctg aatcccttca
     1501 gatttccctt gaatacagtg gcctaaagaa tcctgttatt gagatgttag aaggaattgc
     1561 tgttgtctta caactgactg ctctgtgtac tgttcattgt tctcatcaaa acatgaactg
     1621 ccgtactttc aaggactgtc aacataaatc caagaagaaa ccttctgtag tgataacttg
     1681 gatgtcattg gatttttaca caaaagtgct taagagctgt agaagtttgt tagaatctgt
     1741 tcagaaactg gacctggagg caaccattga taaggtggtg aaaatttatg atgctttgat
     1801 ttatatgcaa gtaaacagtt catttgaaga tcatatcctg gaagatttat gtggtatgct
     1861 ctcacttcca tggatttatt cccattctga tgatggctgt ttaaagttga ccacatttgc
     1921 cgctaatctt ctaacattaa gctgtaggat ttcagatagc tattcaccac aggcacaatc
     1981 acgatgtgtg tttcttctga ctctgtttcc aagaagaata ttccttgagt ggagaacagc
     2041 agtttacaac tgggccctgc agagctccca tgaagtaatc cgggctagtt gtgttagtgg
     2101 attttttatc ttattgcagc agcagaattc ttgtaacaga gttcccaaga ttcttataga
     2161 taaagtcaaa gatgattctg acattgtcaa gaaagaattt gcttctatac ttggtcaact
     2221 tgtctgtact cttcacggca tgttttatct gacaagttct ttaacagaac ctttctctga
     2281 acacggacat gtggacctct tctgtaggaa cttgaaagcc acttctcaac atgaatgttc
     2341 atcttctcaa ctaaaagctt ctgtctgcaa gccattcctt ttcctactga aaaaaaaaat
     2401 acctagtcca gtaaaacttg ctttcataga taatctacat catctttgta agcatcttga
     2461 ttttagagaa gatgaaacag atgtaaaagc agttcttgga actttattaa atttaatgga
     2521 agatccagac aaagatgtta gagtggcttt tagtggaaat atcaagcaca tattggaatc
     2581 cttggactct gaagatggat ttataaagga gctttttgtc ttaagaatga aggaagcata
     2641 tacacatgcc caaatatcaa gaaataatga gctgaaggat accttgattc ttacaacagg
     2701 ggatattgga agggccgcaa aaggagattt ggtaccattt gcactcttac acttattgca
     2761 ttgtttgtta tccaagtcag catctgtctc tggagcagca tacacagaaa ttagagctct
     2821 ggttgcagct aaaagtgtta aactgcaaag ttttttcagc cagtataaga aacccatctg
     2881 tcagtttttg gtagaatccc ttcactctag tcagatgaca gcacttccga atactccatg
     2941 ccagaatgct gacgtgcgaa aacaagatgt ggctcaccag agagaaatgg ctttaaatac
     3001 gttgtctgaa attgccaacg ttttcgactt tcctgatctt aatcgttttc ttactaggac
     3061 attacaagtt ctactacctg atcttgctgc caaagcaagc cctgcagctt ctgctctcat
     3121 tcgaacttta ggaaaacaat taaatgtcaa tcgtagagag attttaataa acaacttcaa
     3181 atatattttt tctcatttgg tctgttcttg ttccaaagat gaattagaac gtgcccttca
     3241 ttatctgaag aatgaaacag aaattgaact ggggagcctg ttgagacaag atttccaagg
     3301 attgcataat gaattattgc tgcgtattgg agaacactat caacaggttt ttaatggttt
     3361 gtcaatactt gcctcatttg catccagtga tgatccatat cagggcccga gagatatcat
     3421 atcacctgaa ctgatggctg attatttaca acccaaattg ttgggcattt tggctttttt
     3481 taacatgcag ttactgagct ctagtgttgg cattgaagat aagaaaatgg ccttgaacag
     3541 tttgatgtct ttgatgaagt taatgggacc caaacatgtc agttctgtga gggtgaagat
     3601 gatgaccaca ctgagaactg gccttcgatt caaggatgat tttcctgaat tgtgttgcag
     3661 agcttgggac tgctttgttc gctgcctgga tcatgcttgt ctgggctccc ttctcagtca
     3721 tgtaatagta gctttgttac ctcttataca catccagcct aaagaaactg cagctatctt
     3781 ccactacctc ataattgaaa acagggatgc tgtgcaagat tttcttcatg aaatatattt
     3841 tttacctgat catccagaat taaaaaagat aaaagccgtt ctccaggaat acagaaagga
     3901 gacctctgag agcactgatc ttcagacaac tcttcagctc tctatgaagg ccattcaaca
     3961 tgaaaatgtc gatgttcgta ttcatgctct tacaagcttg aaggaaacct tgtataaaaa
     4021 tcaggaaaaa ctgataaagt atgcaacaga cagtgaaaca gtagaaccta ttatctcaca
     4081 gttggtgaca gtgcttttga aaggttgcca agatgcaaac tctcaagctc ggttgctctg
     4141 tggggaatgt ttaggggaat tgggggcgat agatccaggt cgattagatt tctcaacaac
     4201 tgaaactcaa ggaaaagatt ttacatttgt gactggagta gaagattcaa gctttgccta
     4261 tggattattg atggagctaa caagagctta ccttgcgtat gctgataata gccgagctca
     4321 agattcagct gcctatgcca ttcaggagtt gctttctatt tatgactgta gagagatgga
     4381 gaccaacggc ccaggtcacc aattgtggag gagatttcct gagcatgttc gggaaatact
     4441 agaacctcat ctaaatacca gatacaagag ttctcagaag tcaaccgatt ggtctggagt
     4501 aaagaagcca atttacttaa gtaaattggg tagtaacttt gcagaatggt cagcatcttg
     4561 ggcaggttat cttattacaa aggttcgaca tgatcttgcc agtaaaattt tcacctgctg
     4621 tagcattatg atgaagcatg atttcaaagt gaccatctat cttcttccac atattctggt
     4681 gtatgtctta ctgggttgta atcaagaaga tcagcaggag gtttatgcag aaattatggc
     4741 agttctaaag catgacgatc agcataccat aaatacccaa gacattgcat ctgatctgtg
     4801 tcaactcagt acacagactg tgttctccat gcttgaccat ctcacacagt gggcaaggca
     4861 caaatttcag gcactgaaag ctgagaaatg tccacacagc aaatcaaaca gaaataaggt
     4921 agactcaatg gtatctactg tggattatga agactatcag agtgtaaccc gttttctaga
     4981 cctcataccc caggatactc tggcagtagc ttcctttcgc tccaaagcat acacacgagc
     5041 tgtaatgcac tttgaatcat ttattacaga aaagaagcaa aatattcagg aacatcttgg
     5101 atttttacag aaattgtatg ctgctatgca tgaacctgat ggagtggccg gagtcagtgc
     5161 aattagaaag gcagaaccat ctctaaaaga acagatcctt gaacatgaaa gccttggctt
     5221 gctgagggat gccactgctt gttatgacag ggctattcag ctagaaccag accagatcat
     5281 tcattatcat ggtgtagtaa agtccatgtt aggtcttggt cagctgtcta ctgttatcac
     5341 tcaggtgaat ggagtgcatg ctaacaggtc cgagtggaca gatgaattaa acacgtacag
     5401 agtggaagca gcttggaaat tgtcacagtg ggatttggtg gaaaactatt tggcagcaga
     5461 tggaaaatct acaacatgga gtgtcagact gggacagcta ttattatcag ccaaaaaaag
     5521 agatatcaca gctttttatg actcactgaa actagtgaga gcagaacaaa ttgtacctct
     5581 ttcagctgca agctttgaaa gaggctccta ccaacgagga tatgaatata ttgtgagatt
     5641 gcacatgtta tgtgagttgg agcatagcat caaaccactt ttccagcatt ctccaggtga
     5701 cagttctcaa gaagattctc taaactgggt agctcgacta gaaatgaccc agaattccta
     5761 cagagccaag gagcctatcc tggctctccg gagggcttta ctaagcctca acaaaagacc
     5821 agattacaat gaaatggttg gagaatgctg gctgcagagt gccagggtag ctagaaaggc
     5881 tggtcaccac cagacagcct acaatgctct ccttaatgca ggggaatcac gactcgctga
     5941 actgtacgtg gaaagggcaa agtggctctg gtccaagggt gatgttcacc aggcactaat
     6001 tgttcttcaa aaaggtgttg aattatgttt tcctgaaaat gaaaccccac ctgagggtaa
     6061 gaacatgtta atccatggtc gagctatgct actagtgggc cgatttatgg aagaaacagc
     6121 taactttgaa agcaatgcaa ttatgaaaaa atataaggat gtgaccgcgt gcctgccaga
     6181 atgggaggat gggcattttt accttgccaa gtactatgac aaattgatgc ccatggtcac
     6241 agacaacaaa atggaaaagc aaggtgatct catccggtat atagttcttc attttggcag
     6301 atctctacaa tatggaaatc agttcatata tcagtcaatg ccacgaatgt taactctatg
     6361 gcttgattat ggtacaaagg catatgaatg ggaaaaagct ggccgctccg atcgtgtaca
     6421 aatgaggaat gatttgggta aaataaacaa ggttatcaca gagcatacaa actatttagc
     6481 tccatatcaa tttttgactg ctttttcaca attgatctct cgaatttgtc attctcacga
     6541 tgaagttttt gttgtcttga tggaaataat agccaaagta tttctagcct atcctcaaca
     6601 agcaatgtgg atgatgacag ctgtgtcaaa gtcatcttat cccatgcgtg tgaacagatg
     6661 caaggaaatc ctcaataaag ctattcatat gaaaaaatcc ttagagaagt ttgttggaga
     6721 tgcaactcgc ctaacagata agcttctaga attgtgcaat aaaccggttg atggaagtag
     6781 ttccacatta agcatgagca ctcattttaa aatgcttaaa aagctggtag aagaagcaac
     6841 atttagtgaa atcctcattc ctctacaatc agtcatgata cctacacttc catcaattct
     6901 gggtacccat gctaaccatg ctagccatga accatttcct ggacattggg cctatattgc
     6961 agggtttgat gatatggtgg aaattcttgc ttctcttcag aaaccaaaga agatttcttt
     7021 aaaaggctca gatggaaagt tctacatcat gatgtgtaag ccaaaagatg acctgagaaa
     7081 ggattgtaga ctaatggaat tcaattcctt gattaataag tgcttaagaa aagatgcaga
     7141 gtctcgtaga agagaacttc atattcgaac atatgcagtt attccactaa atgatgaatg
     7201 tgggattatt gaatgggtga acaacactgc tggtttgaga cctattctga ccaaactata
     7261 taaagaaaag ggagtgtata tgacaggaaa agaacttcgc cagtgtatgc taccaaagtc
     7321 agcagcttta tctgaaaaac tcaaagtatt ccgagaattt ctcctgccca ggcatcctcc
     7381 tatttttcat gagtggtttc tgagaacatt ccctgatcct acatcatggt acagtagtag
     7441 atcagcttac tgccgttcca ctgcagtaat gtcaatggtt ggttatattc tggggcttgg
     7501 agaccgtcat ggtgaaaata ttctctttga ttctttgact ggtgaatgcg tacatgtaga
     7561 tttcaattgt cttttcaata agggagaaac ctttgaagtt ccagaaattg tgccatttcg
     7621 cctgactcat aatatggtta atggaatggg tcctatggga acagagggtc tttttcgaag
     7681 agcatgtgaa gttacaatga ggctgatgcg tgatcagcga gagcctttaa tgagtgtctt
     7741 aaagactttt ctacatgatc ctcttgtgga atggagtaaa ccagtgaaag ggcattccaa
     7801 agcgccactg aatgaaactg gagaagttgt caatgaaaag gccaagaccc atgttcttga
     7861 cattgagcag cgactacaag gtgtaatcaa gactcgaaat agagtgacag gactgccgtt
     7921 atctattgaa ggacatgtgc attaccttat acaagaagct actgatgaaa acttactatg
     7981 ccagatgtat cttggttgga ctccatatat gtgaaatgaa attatgtaaa agaatatgtt
     8041 aataatctaa aagtaatgca tttggtatga atctgtggtt gtatctgttc aattctaaag
     8101 tacaacataa atttacgttc tcagcaactg ttatttctct ctgatcatta attatatgta
     8161 aaataatata cattcagtta ttaagaaata aactgctttc ttaataaaaa aaaaaaaaaa
     8221 aaaaaaaaaa aaaaaaaaa
//