LOCUS       HSU69961                2125 bp    mRNA    linear   HUM 13-MAY-1998
DEFINITION  Homo sapiens solurshin (RGS) mRNA, complete cds.
ACCESSION   U69961
VERSION     U69961.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2125)
  AUTHORS   Semina,E.V., Reiter,R., Leysens,N.J., Alward,W.L.M., Small,K.W.,
            Datson,N.A., Siegle-Bartelt,J., Bierke-Nelson,D., Bitoun,P.,
            Zabel,B.U., Carey,J.C. and Murray,J.C.
  TITLE     Cloning and characterization of a novel bicoid-related homeobox
            transcription factor gene, RIEG, involved in Rieger syndrome
  JOURNAL   Nat. Genet. 14 (4), 392-399 (1996)
   PUBMED   8944018
REFERENCE   2  (bases 1 to 2125)
  AUTHORS   Semina,E.V.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-SEP-1996) Pediatrics, University of Iowa, 140
            Eckstein Medical Research Building, Iowa City, IA 52242, USA
FEATURES             Location/Qualifiers
     source          1..2125
                     /db_xref="H-InvDB:HIT000221084"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q25"
     gene            1..2125
                     /gene="RGS"
     CDS             584..1399
                     /gene="RGS"
                     /note="Rieger syndrome; bicoid-related homeodomain
                     protein; transcription factor"
                     /codon_start=1
                     /product="solurshin"
                     /protein_id="AAC16257.1"
                     /db_xref="GI:1737167"
                     /translation="METNCRKLVSACLQLEKDKSQQGKNEDVGAEDPSKKKRQRRQRT
                     HFTSQQLQQLEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQ
                     AELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLS
                     SQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPY
                     APPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQKPASNLSACQYAVDRPV"
BASE COUNT          548 a          560 c          548 g          469 t
ORIGIN      
        1 tgggagtccg tgctcctgct cctcggttgg ctcctaagtg ccccgccagg tcccctctcc
       61 tttcgctctc ccggctccgg ctcccgactc ttcggcccgc tggcatctgc ttccctcccc
      121 tgcctcgttt ctcgtcgccc ctgctcgctc cccccggcgc tcgcccgggc gctgtgctcg
      181 ctcctggatc gccagccgcg cagccgggct cggccggccg cccgcgcgcc actgtgcagt
      241 ggagtttggt ggaatctctg ctgacgtcac gtcactcccc acacggagta ggagcagagg
      301 gaagagagag ggatgagagg gagggagagg agagagagtg cgagaccgag cgagaaagct
      361 ggagaggagc agaaagaaac tgccagtggc ggctagattt cggaggcccc agtgcacccg
      421 tggactcctt cggaacttgg caccctcagg agccctgcag tcctctcagg cccggctttc
      481 gggcgcttgc cgtgcagccg gaggctcggc tcgctggaaa tcgccccggg aagcagtggg
      541 acgcggagac agcagctctc tcccggtagc cgataacggg gaaatggaga ccaactgccg
      601 caaactggtg tcggcgtgtc tgcaattaga gaaagataaa agccagcagg ggaagaatga
      661 ggacgtgggc gccgaggacc cgtctaagaa gaagcggcaa aggcggcagc ggactcactt
      721 taccagccag cagctccagc agctggaggc cactttccag aggaaccgct acccggacat
      781 gtccacacgc gaagaaatcg ctgtgtggac caaccttacg gaagcccgag tccgggtttg
      841 gttcaagaat cgtcgggcca aatggagaaa gagggagcgc aaccagcagg ccgagctatg
      901 caagaatggc ttcgggccgc agttcaatgg gctcatgcag ccctacgacg acatgtaccc
      961 aggctattcc tacaacaact gggccgccaa gggccttaca tccgcctccc tatccaccaa
     1021 gagcttcccc ttcttcaact ctatgaacgt caaccccctg tcatcacaga gcatgttttc
     1081 cccacccaac tctatctcgt ccatgagcat gtcgtccagc atggtgccct cagcagtgac
     1141 aggcgtcccg ggctccagtc tcaacagcct gaataacttg aacaacctga gtagcccgtc
     1201 gctgaattcc gcggtgccga cgcctgcctg tccttacgcg ccgccgactc ctccgtatgt
     1261 ttatagggac acgtgtaact cgagcctggc cagcctgaga ctgaaagcaa agcagcactc
     1321 cagcttcggc tacgccagcg tgcagaaacc ggcctccaac ctgagtgctt gccagtatgc
     1381 agtggaccgg cccgtgtgag ccgcacccac agcgccggga tcctaggacc ttgccggatg
     1441 gggcaactcc gcccttgaaa gactgggaat tatgctagaa ggtcgtgggc actaaagaaa
     1501 gggagagaaa gagaagctat atagagaaaa ggaaaccact gaatcaaaga gagagctcct
     1561 ttgatttcaa agggatgtcc tcagtgtctg acatctttca ctacaagtat ttctaacagt
     1621 tgcaaggaca catacacaaa caaatgtttt gactggatat gacattttaa cattactata
     1681 agcttgttat tttttaagtt tagcattgtt aacatttaaa tgactgaaag gatgtatata
     1741 tatcgaaatg tcaaattaat tttataaaag cagttgttag taatatcaca acagtgtttt
     1801 taaaggttag gctttaaaat aaagcatgtt atacagaagc gattaggatt tttcgcttgc
     1861 gagcaaggga gtgtatatac taaatgccac actgtatgtt tctaacatat tattattatt
     1921 ataaaaaatg tgtgaatatc agttttagaa tagtttgtgt ggtggatgca atgatgtttc
     1981 tgaaactgct atgtacaacc taccctgtgt ataacatttc gtacaatatt attgttttac
     2041 ttttcagcaa atatgaaaca aatgtgtttt attttcatgg gagtaaaata tactgcatac
     2101 aaaaaaaaaa aaaaaaaaaa aaaaa
//