LOCUS       HSU69611                3014 bp    mRNA    linear   HUM 09-APR-1997
DEFINITION  Human TNF-alpha converting enzyme mRNA, complete cds.
ACCESSION   U69611
VERSION     U69611.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3014)
  AUTHORS   Black,R.A., Rauch,C.T., Kozlosky,C.J., Peschon,J.J., Slack,J.L.,
            Wolfson,M.F., Castner,B.J., Stocking,K.L., Reddy,P., Srinivasan,S.,
            Nelson,N., Bioani,N., Schooley,K.A., Gerhart,M., Davis,R.,
            Fitzner,J.N., Johnson,R.S., Paxton,R.J., March,C.J. and
            Cerretti,D.P.
  TITLE     A metalloproteinase disintegrin that releases tumour-necrosis
            factor-alpha from cells
  JOURNAL   Nature 385 (6618), 729-733 (1997)
   PUBMED   9034190
REFERENCE   2  (bases 1 to 3014)
  AUTHORS   Cerretti,D.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-SEP-1996) Molecular Biology, Immunex Corp., 51
            University St., Seattle, WA 98101, USA
FEATURES             Location/Qualifiers
     source          1..3014
                     /db_xref="H-InvDB:HIT000221077"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             115..2589
                     /note="transmembrane metalloproteinase/disintegrin;
                     adamalysin; TACEA"
                     /codon_start=1
                     /product="TNF-alpha converting enzyme"
                     /protein_id="AAB51514.1"
                     /db_xref="GI:1858022"
                     /translation="MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDI
                     LSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGK
                     NESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTK
                     DKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADP
                     DPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYG
                     IQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCL
                     AHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGK
                     TILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMF
                     SNCSKQSIYKTIESKAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTL
                     KEGVQCSDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDDTV
                     CLDLGKCKDGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFL
                     RKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNIVGSVLVFSLI
                     FWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQ
                     PAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDH
                     PVTRSEKAASFKLQRQNRVDSKETEC"
     misc_feature    2128..2296
                     /note="encodes transmembrane domain"
BASE COUNT          886 a          595 c          735 g          798 t
ORIGIN      
        1 ggattgaggg gctaggccgg gcggatcccg tcctcccccg atgtgagcag ttttccgaaa
       61 ccccgtcagg cgaaggctgc ccagagaggt ggagtcggta gcggggccgg gaacatgagg
      121 cagtctctcc tattcctgac cagcgtggtt cctttcgtgc tggcgccgcg acctccggat
      181 gacccgggct tcggccccca ccagagactc gagaagcttg attctttgct ctcagactac
      241 gatattctct ctttatctaa tatccagcag cattcggtaa gaaaaagaga tctacagact
      301 tcaacacatg tagaaacact actaactttt tcagctttga aaaggcattt taaattatac
      361 ctgacatcaa gtactgaacg tttttcacaa aatttcaagg tcgtggtggt ggatggtaaa
      421 aacgaaagcg agtacactgt aaaatggcag gacttcttca ctggacacgt ggttggtgag
      481 cctgactcta gggttctagc ccacataaga gatgatgatg ttataatcag aatcaacaca
      541 gatggggccg aatataacat agagccactt tggagatttg ttaatgatac caaagacaaa
      601 agaatgttag tttataaatc tgaagatatc aagaatgttt cacgtttgca gtctccaaaa
      661 gtgtgtggtt atttaaaagt ggataatgaa gagttgctcc caaaagggtt agtagacaga
      721 gaaccacctg aagagcttgt tcatcgagtg aaaagaagag ctgacccaga tcccatgaag
      781 aacacgtgta aattattggt ggtagcagat catcgcttct acagatacat gggcagaggg
      841 gaagagagta caactacaaa ttacttaata gagctaattg acagagttga tgacatctat
      901 cggaacactt catgggataa tgcaggtttt aaaggctatg gaatacagat agagcagatt
      961 cgcattctca agtctccaca agaggtaaaa cctggtgaaa agcactacaa catggcaaaa
     1021 agttacccaa atgaagaaaa ggatgcttgg gatgtgaaga tgttgctaga gcaatttagc
     1081 tttgatatag ctgaggaagc atctaaagtt tgcttggcac accttttcac ataccaagat
     1141 tttgatatgg gaactcttgg attagcttat gttggctctc ccagagcaaa cagccatgga
     1201 ggtgtttgtc caaaggctta ttatagccca gttgggaaga aaaatatcta tttgaatagt
     1261 ggtttgacga gcacaaagaa ttatggtaaa accatcctta caaaggaagc tgacctggtt
     1321 acaactcatg aattgggaca taattttgga gcagaacatg atccggatgg tctagcagaa
     1381 tgtgccccga atgaggacca gggagggaaa tatgtcatgt atcccatagc tgtgagtggc
     1441 gatcacgaga acaataagat gttttcaaac tgcagtaaac aatcaatcta taagaccatt
     1501 gaaagtaagg cccaggagtg ttttcaagaa cgcagcaata aagtttgtgg gaactcgagg
     1561 gtggatgaag gagaagagtg tgatcctggc atcatgtatc tgaacaacga cacctgctgc
     1621 aacagcgact gcacgttgaa ggaaggtgtc cagtgcagtg acaggaacag tccttgctgt
     1681 aaaaactgtc agtttgagac tgcccagaag aagtgccagg aggcgattaa tgctacttgc
     1741 aaaggcgtgt cctactgcac aggtaatagc agtgagtgcc cgcctccagg aaatgctgaa
     1801 gatgacactg tttgcttgga tcttggcaag tgtaaggatg ggaaatgcat ccctttctgc
     1861 gagagggaac agcagctgga gtcctgtgca tgtaatgaaa ctgacaactc ctgcaaggtg
     1921 tgctgcaggg acctttccgg ccgctgtgtg ccctatgtcg atgctgaaca aaagaactta
     1981 tttttgagga aaggaaagcc ctgtacagta ggattttgtg acatgaatgg caaatgtgag
     2041 aaacgagtac aggatgtaat tgaacgattt tgggatttca ttgaccagct gagcatcaat
     2101 acttttggaa agtttttagc agacaacatc gttgggtctg tcctggtttt ctccttgata
     2161 ttttggattc ctttcagcat tcttgtccat tgtgtggata agaaattgga taaacagtat
     2221 gaatctctgt ctctgtttca ccccagtaac gtcgaaatgc tgagcagcat ggattctgca
     2281 tcggttcgca ttatcaaacc ctttcctgcg ccccagactc caggccgcct gcagcctgcc
     2341 cctgtgatcc cttcggcgcc agcagctcca aaactggacc accagagaat ggacaccatc
     2401 caggaagacc ccagcacaga ctcacatatg gacgaggatg ggtttgagaa ggaccccttc
     2461 ccaaatagca gcacagctgc caagtcattt gaggatctca cggaccatcc ggtcaccaga
     2521 agtgaaaagg ctgcctcctt taaactgcag cgtcagaatc gtgttgacag caaagaaaca
     2581 gagtgctaat ttagttctca gctcttctga cttaagtgtg caaaatattt ttatagattt
     2641 gacctacaat caatcacagc ttatattttg tgaagactgg gaagtgactt agcagatgct
     2701 ggtcatgtgt ttgaacttcc tgcaggtaaa cagttcttgt gtggtttggc ccttctcctt
     2761 ttgaaaaggt aaggtgaagg tgaatctagc ttattttgag gctttcaggt tttagttttt
     2821 aaaatatctt ttgacctgtg gtgcaaaagc agaaaataca gctggattgg gttatgagta
     2881 tttacgtttt tgtaaattaa tcttttatat tgataacagc actgactagg gaaatgatca
     2941 gttttttttt tatacactgt aatgaaccgc tgaatatgag gcatttggca tttatttgtg
     3001 atgacaactg gaat
//