LOCUS       HSU65019                1605 bp    mRNA    linear   HUM 12-OCT-1996
DEFINITION  Human MAD-related protein 2 (MADR2) mRNA, complete cds.
ACCESSION   U65019
VERSION     U65019.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1605)
  AUTHORS   Eppert,K., Scherer,S.W., Ozcelik,H., Pirone,R., Hoodless,P.,
            Kim,H., Tsui,L.-C., Bapat,B., Gallinger,S., Andrulis,I.L.,
            Thomsen,G.H., Wrana,J.L. and Attisano,L.
  TITLE     MADR2 maps to 18q21 and encodes a TGFbeta-regulated MAD-related
            protein that is functionally mutated in colorectal carcinoma
  JOURNAL   Cell 86 (4), 543-552 (1996)
   PUBMED   8752209
REFERENCE   2  (bases 1 to 1605)
  AUTHORS   Attisano,L., Pirone,R., Hoodless,P. and Wrana,J.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-1996) Anatomy and Cell Biology, University of
            Toronto, Medical Sciences Building, Toronto, Ontario M5S 1A8,
            Canada
FEATURES             Location/Qualifiers
     source          1..1605
                     /db_xref="H-InvDB:HIT000220870"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="18"
                     /map="18q21"
     gene            1..1605
                     /gene="MADR2"
     CDS             37..1440
                     /gene="MADR2"
                     /codon_start=1
                     /product="MAD-related protein 2"
                     /protein_id="AAB17054.1"
                     /db_xref="GI:1575530"
                     /translation="MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKA
                     VKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLY
                     SFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEV
                     CVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIP
                     ETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCS
                     IAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGR
                     GVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA
                     LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLD
                     KVLTQMGSPSVRCSSMS"
BASE COUNT          477 a          342 c          361 g          419 t
ORIGIN      
        1 ttttcctagc gtggcttgct gcctttggtn aagaacatgt cgtccatctt gccattcacg
       61 ccgccagttg tgaagagact gctgggatgg aagaagtcag ctggtgggtc tggaggagca
      121 ggcggaggag agcagaatgg gcaggaagaa aagtggtgtg agaaagcagt gaaaagtctg
      181 gtgaagaagc taaagaaaac aggacgatta gatgagcttg agaaagccat caccactcaa
      241 aactgtaata ctaaatgtgt taccatacca agcacttgct ctgaaatttg gggactgagt
      301 acaccaaata cgatagatca gtgggataca acaggccttt acagcttctc tgaacaaacc
      361 aggtctcttg atggtcgtct ccaggtatcc catcgaaaag gattgccaca tgttatatat
      421 tgccgattat ggcgctggcc tgatcttcac agtcatcatg aactcaaggc aattgaaaac
      481 tgcgaatatg cttttaatct taaaaaggat gaagtatgtg taaaccctta ccactatcag
      541 agagttgaga caccagtttt gcctccagta ttagtgcccc gacacaccga gatcctaaca
      601 gaacttccgc ctctggatga ctatactcac tccattccag aaaacactaa cttcccagca
      661 ggaattgagc cacagagtaa ttatattcca gaaacgccac ctcctggata tatcagtgaa
      721 gatggagaaa caagtgacca acagttgaat caaagtatgg acacaggctc tccagcagaa
      781 ctatctccta ctactctttc ccctgttaat catagcttgg atttacagcc agttacttac
      841 tcagaacctg cattttggtg ttcgatagca tattatgaat taaatcagag ggttggagaa
      901 accttccatg catcacagcc ctcactcact gtagatggct ttacagaccc atcaaattca
      961 gagaggttct gcttaggttt actctccaat gttaaccgaa atgccacggt agaaatgaca
     1021 agaaggcata taggaagagg agtgcgctta tactacatag gtggggaagt ttttgctgag
     1081 tgcctaagtg atagtgcaat ctttgtgcag agccccaatt gtaatcagag atatggctgg
     1141 caccctgcaa cagtgtgtaa aattccacca ggctgtaatc tgaagatctt caacaaccag
     1201 gaatttgctg ctcttctggc tcagtctgtt aatcagggtt ttgaagccgt ctatcagcta
     1261 actagaatgt gcaccataag aatgagtttt gtgaaagggt ggggagcaga ataccgaagg
     1321 cagacggtaa caagtactcc ttgctggatt gaacttcatc tgaatggacc tctacagtgg
     1381 ttggacaaag tattaactca gatgggatcc ccttcagtgc gttgctcaag catgtcataa
     1441 agcttcacca atcaagtccc atggaaaaga cttaatgtaa caactcttct gttcattagc
     1501 attgtgttgt ngtccctatg ggactgttta ctattccaaa agtttcaagg agagaaaaca
     1561 gcanttgagg tctccntcat ttaaagnacc ctgtnggatt ttttt
//