LOCUS       HSU63333                1302 bp    mRNA    linear   HUM 30-NOV-2000
DEFINITION  Human serine/threonine protein kinase (LKB1) mRNA, complete cds.
ACCESSION   U63333
VERSION     U63333.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1302)
  AUTHORS   Jenne,D.E., Reimann,H., Nezu,J., Friedel,W., Loff,S., Jeschke,R.,
            Muller,O., Back,W. and Zimmer,M.
  TITLE     Peutz-Jeghers syndrome is caused by mutations in a novel serine
            threonine kinase
  JOURNAL   Nat. Genet. 18 (1), 38-43 (1998)
   PUBMED   9425897
REFERENCE   2  (bases 1 to 1302)
  AUTHORS   Nezu,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUL-1996) Fuji Gotemba Research Labs., Chugai
            Pharmaceutical Co., LTD., 135, Komakado, 1 Chome, Gotemba-shi,
            Shizuoka 412, Japan
FEATURES             Location/Qualifiers
     source          1..1302
                     /db_xref="H-InvDB:HIT000220768"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="liver"
                     /dev_stage="fetal"
     gene            1..1302
                     /gene="LKB1"
     CDS             1..1302
                     /gene="LKB1"
                     /codon_start=1
                     /product="serine/threonine protein kinase"
                     /protein_id="AAB05809.1"
                     /db_xref="GI:1480861"
                     /translation="MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAK
                     LIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLL
                     RRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQL
                     IDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPA
                     FQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPG
                     DCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRS
                     MTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCM
                     NGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ"
BASE COUNT          296 a          384 c          414 g          208 t
ORIGIN      
        1 atggaggtgg tggacccgca gcagctgggc atgttcacgg agggcgagct gatgtcggtg
       61 ggtatggaca cgttcatcca ccgcatcgac tccaccgagg tcatctacca gccgcgccgc
      121 aagcgggcca agctcatcgg caagtacctg atgggggacc tgctggggga aggctcttac
      181 ggcaaggtga aggaggtgct ggactcggag acgctgtgca ggagggccgt caagatcctc
      241 aagaagaaga agttgcgaag gatccccaac ggggaggcca acgtgaagaa ggaaattcaa
      301 ctactgagga ggttacggca caaaaatgtc atccagctgg tggatgtgtt atacaacgaa
      361 gagaagcaga aaatgtatat ggtgatggag tactgcgtgt gtggcatgca ggaaatgctg
      421 gacagcgtgc cggagaagcg tttcccagtg tgccaggccc acgggtactt ctgtcagctg
      481 attgacggcc tggagtacct gcatagccag ggcattgtgc acaaggacat caagccgggg
      541 aacctgctgc tcaccaccgg tggcaccctc aaaatctccg acctgggcgt ggccgaggca
      601 ctgcacccgt tcgcggcgga cgacacctgc cggaccagcc agggctcccc ggctttccag
      661 ccgcccgaga ttgccaacgg cctggacacc ttctccggct tcaaggtgga catctggtcg
      721 gctggggtca ccctctacaa catcaccacg ggtctgtacc ccttcgaagg ggacaacatc
      781 tacaagttgt ttgagaacat cgggaagggg agctacgcca tcccgggcga ctgtggcccc
      841 ccgctctctg acctgctgaa agggatgctt gagtacgaac cggccaagag gttctccatc
      901 cggcagatcc ggcagcacag ctggttccgg aagaaacatc ctccggctga agcaccagtg
      961 cccatcccac cgagcccaga caccaaggac cggtggcgca gcatgactgt ggtgccgtac
     1021 ttggaggacc tgcacggcgc ggacgaggac gaggacctct tcgacatcga ggatgacatc
     1081 atctacactc aggacttcac ggtgcccgga caggtcccag aagaggaggc cagtcacaat
     1141 ggacagcgcc ggggcctccc caaggccgtg tgtatgaacg gcacagaggc ggcgcagctg
     1201 agcaccaaat ccagggcgga gggccgggcc cccaaccctg cccgcaaggc ctgctccgcc
     1261 agcagcaaga tccgccggct gtcggcctgc aagcagcagt ga
//