LOCUS       HSU62961                3337 bp    mRNA    linear   HUM 04-SEP-1996
DEFINITION  Human succinyl CoA:3-oxoacid CoA transferase precursor (OXCT) mRNA,
            complete cds.
ACCESSION   U62961
VERSION     U62961.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3337)
  AUTHORS   Kassovska-Bratinova,S.G., Fukao,T., Song,X., Duncan,A., Chen,H.,
            Robert,M., Chartrand,C., Vobecky,S., Perez-Cerda,C., Ugarte,M.,
            Kondo,N. and Mitchell,G.A.
  TITLE     Succinyl CoA:3-oxoacid CoA transferase (SCOT): human cDNA cloning,
            human chromosomal mapping to 5p13, and mutation detection in a
            SCOT-deficient patient
  JOURNAL   Am. J. Hum. Genet. 59 59, 519-528 (1996)
REFERENCE   2  (bases 1 to 3337)
  AUTHORS   Mitchell,G.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUL-1996) Genetique Medicale, Hopital Ste Justine,
            3175, Cote Ste Catherine, Montreal, Quebec H3T 1C5, Canada
FEATURES             Location/Qualifiers
     source          1..3337
                     /db_xref="H-InvDB:HIT000220746"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="proximal 5p13"
                     /clone="SCOT-B, SCOT-C, SCOT-D, SCOT-F, SCOT-G"
                     /tissue_type="heart"
     gene            1..3337
                     /gene="OXCT"
     5'UTR           1..98
                     /gene="OXCT"
     CDS             99..1661
                     /gene="OXCT"
                     /EC_number="2.8.3.5"
                     /function="key enzyme of ketolysis catalyses the transfer
                     of CoA from succinyl-CoA to 3-oxoacids such as acetoacetic
                     acid"
                     /codon_start=1
                     /product="succinyl CoA:3-oxoacid CoA transferase
                     precursor"
                     /protein_id="AAB07366.1"
                     /db_xref="GI:1519052"
                     /translation="MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYT
                     DPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLL
                     LRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTG
                     YGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRA
                     GNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYE
                     KRIERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFIS
                     PNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGG
                     HVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAH
                     KIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAV
                     SPKLMPMQQIAN"
     sig_peptide     99..215
                     /gene="OXCT"
     mat_peptide     216..1658
                     /gene="OXCT"
                     /product="succinyl CoA:3-oxoacid CoA transferase"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    1128..1130
                     /gene="OXCT"
                     /note="encodes Glu-344 within the enzyme's active site"
     3'UTR           1662..3320
                     /gene="OXCT"
     polyA_signal    3300..3305
                     /gene="OXCT"
     polyA_site      3321
                     /gene="OXCT"
BASE COUNT          994 a          620 c          770 g          953 t
ORIGIN      
        1 gtcgagcctc tagcccgccc gggtttcctt cgcagtcgcg caccgacgct caaacgcgcg
       61 ctccaacccg cagcctcctc ctgcctcacc gcccgaagat ggcggctctc aaactcctct
      121 cctccgggct tcggctctgc gcctctgccc gcggatctgg ggcaacctgg tacaagggat
      181 gtgtttgttc cttttccacc agtgctcatc gccataccaa gttttataca gatccagtag
      241 aagctgtaaa agacatccct gatggtgcca cggttttggt tggtggtttt gggctatgtg
      301 gaattccaga gaatcttata gatgctttac tgaaaactgg agtaaaagga ctaactgcag
      361 tcagcaacaa tgcaggggtt gacaattttg gtttggggct tttgcttcgg tcgaagcaga
      421 taaaacgcat ggtctcttca tatgtgggag aaaatgcaga atttgaacga cagtacttat
      481 ctggtgaatt agaagtggag ctgacaccac agggcacact tgcagagagg atccgtgcag
      541 gcggggctgg agttcctgca ttttacaccc caacagggta tgggaccctg gtacaagaag
      601 gaggatcgcc catcaaatac aacaaagatg gcagtgttgc cattgccagt aagccaagag
      661 aggtgaggga gttcaatggt cagcacttta ttttggagga agcaattaca ggggattttg
      721 ctttggtgaa agcctggaag gcggaccgag caggaaacgt gattttcagg aaaagtgcaa
      781 ggaatttcaa cttgccaatg tgcaaagctg cagaaaccac agtggtagag gttgaagaaa
      841 ttgtggatat tggagcattt gctccagaag acatccatat tcctcagatt tatgtacatc
      901 gccttataaa gggagaaaaa tatgagaaaa gaattgagcg tttatcaatc cggaaagagg
      961 gagatgggga agccaaatct gctaaacctg gagatgacgt aagggaacga atcatcaaga
     1021 gggccgctct tgagtttgag gatggcatgt atgctaattt gggcatagga atccctctcc
     1081 tggccagcaa ttttatcagc ccaaatataa ctgttcatct tcaaagtgaa aatggagttc
     1141 tgggtttggg tccatatcca cgacaacatg aagctgatgc agatctcatc aatgcaggca
     1201 aggaaacagt tactattctt ccaggagcct cttttttctc cagcgatgaa tcatttgcaa
     1261 tgattagagg tggacacgtc gatctgacaa tgctaggagc gatgcaggtt tccaaatatg
     1321 gtgacctggc taactggatg atacctggga agatggtgaa aggaatggga ggtgctatgg
     1381 atttagtgtc cagtgcgaaa accaaagtgg tggtcaccat ggagcattct gcaaagggaa
     1441 atgcacataa aatcatggag aaatgtacat taccattgac tggaaagcaa tgtgtcaacc
     1501 gcattattac tgaaaaggct gtgtttgatg tggacaagaa gaaagggttg actctgattg
     1561 agctctggga aggcctgaca gtggatgacg tacaaaagag tactgggtgt gattttgcag
     1621 tttcaccaaa actcatgcca atgcagcaga tcgcaaattg aaatatggat atttgtacca
     1681 ggctgcgtgt ttttcatttt aaacacacaa gatttaattg aaaggacatc aataatcata
     1741 attgtgtatt taacaggtgg ttttttatta gttttcttgt gtttcagact ttatgcagcc
     1801 atataaactg ttctctaggc atgctgtgac attttaataa aaagcaaaag gagcatttat
     1861 aattatctca tttgttaagg ctgagaaggt tgtttttata ataggtaatt atattgaatg
     1921 cattttcact gaatatggta tgtatgctaa attatatgaa cctttcccca agaagggccc
     1981 tagaaattga tgtggctttc ctcttaaata ttaattatta gtcctgaaag aaagataaca
     2041 tatgtgattt ttgtggttag gagagttgct gtcatgattg ttttttcttc agcctcctct
     2101 gacttttctt ttggggcttc agattttatg attacatctt gtccccctag aacatccccc
     2161 ttcctcccat actgctttta aacagatgcc caagaaggca agcaggaatg cctcttgtgg
     2221 gggagggcag ggagaaataa ctagttcaaa ccaactatct atctatgctt tgcaaagact
     2281 aaggcgtatt ataggaagag ggctagaaac ctaactgatt cttctcagtt ttctcatttt
     2341 aaaacagccc agtattcctt tgtatcctca agggtccttg agaatacttc tgttattgaa
     2401 accctgtggg ctacttgtac tgtacctcct ctcaagccaa gaagggctgt gggataattt
     2461 accatgaatc cttagtagca atgacagcag agttaaaaaa taaaaggtgt tttactttca
     2521 ggctcttgtt ttggttcaga ggagatttta aatattgaat gacacttcta cagaacaacg
     2581 gtttttcttc tgccaaggct acttccttta acgaagtgcc tttaattcag ccttatccaa
     2641 ctagggaaaa taatgttgga caagtctagg atttgaagag tcagtgaact tttagtgtca
     2701 gggaataaac atggtgggta gattaggttt gaaaaaaact tccttagagg tatttattct
     2761 caatacctga caggggccca tgggaatgac ttcagaagca tcccggataa tagatgggta
     2821 aaaagtctag gcaccctgaa gaacaggtga gacagctggc ctctggacag aggtaggcat
     2881 agtacagtac gatatatcat tcctctggtc ctaaatatac aaacttattc atgtttttag
     2941 gtgatgatgg tcattgaaac tcacttcttt tcaggtgtag ctacaattgt gtaatgtaca
     3001 atattagaga aaggacaggc tttttatgag taacacacac catatataaa acagcctttc
     3061 tggctgacca catggttaaa tgcatacctt cccagtactg gggggaaaat gacccttctt
     3121 agaatgtgca agttccatag agtaatatat tgatatgatt ttgaaaagaa ttgttgatag
     3181 ttacatcttc aaacttatca ttccagtatg catctttaag ataatgtgat tctaagtaga
     3241 tgactttata ttcttgatta aagagtgcta tacatgttaa gaaatgcatt aaggaataca
     3301 ataaatattc taaactgatg aaaaaaaaaa aaaaaaa
//