LOCUS       HSU62435                1743 bp    mRNA    linear   HUM 11-JAN-1997
DEFINITION  Human nicotinic acetylcholine receptor alpha6 subunit precursor,
            mRNA, complete cds.
ACCESSION   U62435
VERSION     U62435.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1743)
  AUTHORS   Elliott,K.J., Ellis,S.B., Berckhan,K.J., Urrutia,A.,
            Chavez-Noriega,L.E., Johnson,E.C., Velicelebi,G. and Harpold,M.M.
  TITLE     Comparative structure of human neuronal alpha 2-alpha 7 and beta
            2-beta 4 nicotinic acetylcholine receptor subunits and functional
            expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and
            beta 4 subunits
  JOURNAL   J. Mol. Neurosci. 7 (3), 217-228 (1996)
   PUBMED   8906617
REFERENCE   2  (bases 1 to 1743)
  AUTHORS   Elliott,K.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-1996) Kathryn J. Elliott, SIBIA Neurosciences,
            Inc., 505 Coast Blvd. So., La Jolla, CA 92037, USA
FEATURES             Location/Qualifiers
     source          1..1743
                     /db_xref="H-InvDB:HIT000220719"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="KEalpha6.3"
                     /tissue_type="Substantia nigra"
                     /clone_lib="Clontech #HL1179a, lambda gt10"
     5'UTR           1..142
     CDS             143..1627
                     /codon_start=1
                     /product="nicotinic acetylcholine receptor alpha6 subunit
                     precursor"
                     /protein_id="AAB40113.1"
                     /db_xref="GI:1458118"
                     /translation="MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSH
                     YNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEY
                     DGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPM
                     DITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDI
                     KYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCI
                     SVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTT
                     HTMPRWVKTVFLKLLPQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHL
                     KECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIAENMKSHNETK
                     EVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGNTGKS"
     sig_peptide     143..232
     mat_peptide     233..1624
                     /product="nicotinic acetylcholine receptor alpha6 subunit"
     3'UTR           1628..1743
BASE COUNT          469 a          383 c          396 g          495 t
ORIGIN      
        1 cgggttttga tttctgagaa gacacacacg gattgcagtg ggcttctgat gatgtcaagg
       61 ttggatgcat gtggctgact gatagctctt tgttttccac aatcctttgc ctaggaaaaa
      121 ggaatccaag tgtgttttaa ccatgctgac cagcaagggg cagggattcc ttcatggggg
      181 cttgtgtctc tggctgtgtg tgttcacacc tttctttaaa ggctgtgtgg gctgtgcaac
      241 tgaggagagg ctcttccaca aactgttttc tcattacaac cagttcatca ggcctgtgga
      301 aaacgtttcc gaccctgtca cggtacactt tgaagtggcc atcacccagc tggccaacgt
      361 ggatgaagta aaccagatca tggaaaccaa tttgtggctg cgtcacatct ggaatgatta
      421 taaattgcgc tgggatccaa tggaatatga tggcattgag actcttcgcg ttcctgcaga
      481 taagatttgg aagcccgaca ttgttctcta taacaatgct gttggtgact tccaagtaga
      541 aggcaaaaca aaagctcttc ttaaatacaa tggcatgata acctggactc caccagctat
      601 ttttaagagt tcctgcccta tggatatcac ctttttccct tttgatcatc aaaactgttc
      661 cctaaaattt ggttcctgga cgtatgacaa agctgaaatt gatcttctaa tcattggatc
      721 aaaagtggat atgaatgatt tttgggaaaa cagtgaatgg gaaatcattg atgcctctgg
      781 ctacaaacat gacatcaaat acaactgttg tgaagagata tacacagata taacctattc
      841 tttctacatt agaagattgc cgatgtttta cacgattaat ctgatcatcc cttgtctctt
      901 tatttcattt ctaaccgtgt tggtctttta ccttccttcg gactgtggtg aaaaagtgac
      961 gctttgtatt tcagtcctgc tttctctgac tgtgtttttg ctggtcatca cagaaaccat
     1021 cccatccaca tctctggtgg tcccactggt gggtgagtac ctgctgttca ccatgatctt
     1081 tgtcacactg tccatcgtgg tgactgtgtt tgtgttgaac atacactacc gcaccccaac
     1141 cacgcacaca atgcccaggt gggtgaagac agttttcctg aagctgctgc cccaggtcct
     1201 gctgatgagg tggcctctgg acaagacaag gggcacaggc tctgatgcag tgcccagagg
     1261 ccttgccagg aggcctgcca aaggcaagct tgcaagccat ggggaaccca gacatcttaa
     1321 agaatgcttc cattgtcaca aatcaaatga gcttgccaca agcaagagaa gattaagtca
     1381 tcagccatta cagtgggtgg tggaaaattc ggagcactcg cctgaagttg aagatgtgat
     1441 taacagtgtt cagttcatag cagaaaacat gaagagccac aatgaaacca aggaggtaga
     1501 agatgactgg aaatacgtgg ccatggtggt ggacagagta tttctttggg tatttataat
     1561 tgtctgtgta tttggaactg cagggctatt tctacagcca ctacttggga acacaggaaa
     1621 atcttaaaat gtattttctt ttatgttcag aaatttacag acaccatatt tgttctgcat
     1681 tccctgccac aaggaaagga aagcaaaggc ttcccaccca agtcccccat ctgctaaaac
     1741 ccg
//