LOCUS       HSU59628                2181 bp    mRNA    linear   HUM 26-JAN-1999
DEFINITION  Human PAX-9 mRNA, partial cds.
ACCESSION   U59628
VERSION     U59628.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2181)
  AUTHORS   Nishimura,C.J., Nishimura,D.Y., Padanilam,B.J., Leysens,N.J. and
            Murray,J.C.
  TITLE     Sequence and genetic localization of a human PAX-9 cDNA clone
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2181)
  AUTHORS   Nishimura,C.J., Nishimura,D.Y., Padanilam,B.J., Leysens,N.J. and
            Murray,J.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-1996) Pediatrics, University of Iowa, 140C EMRB,
            Iowa City, IA 52242, USA
FEATURES             Location/Qualifiers
     source          1..2181
                     /db_xref="H-InvDB:HIT000220594"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q12-13"
     gene            1..2181
                     /gene="PAX-9"
     CDS             <1..807
                     /gene="PAX-9"
                     /codon_start=1
                     /protein_id="AAD09487.1"
                     /translation="GLARLRQQDPGAIQRDGLDLARSHRGQQAPGHYPHRGETHPDLQ
                     AERPRHLRLGDPGPPAGGRRVRQVQCALRELHQPHSAQQDRQLGPAGSLRLIQAAPAD
                     AAASAALQPHLLVPQPYHGGGRQGAHATRGACHPRFGGHAAHLALLALRHRHPGHPLH
                     HRPSERQLPLPQPQGGGVEQPGPQQLPRRRPARGERVGEGSPGAGSQVRSGTKWSPSC
                     GQFCVSIQHGSLPYPSPSVALHDLQCCSFWLCCWTWVATCWGHLIVSPQL"
BASE COUNT          572 a          584 c          470 g          555 t
ORIGIN      
        1 ggtctcgcac ggctgcgtca gcaagatcct ggcgcgatac aacgagacgg gctcgatctt
       61 gccaggagcc atcgggggca gcaagccccg ggtcactacc cccaccgtgg tgaaacacat
      121 ccggacctac aagcagagag accccggcat cttcgcctgg gagatccggg accgcctgct
      181 ggcggacggc gtgtgcgaca agtacaatgt gccctccgtg agctccatca gccgcattct
      241 gcgcaacaag atcggcaact tggcccagca gggtcattac gactcataca agcagcacca
      301 gccgacgccg cagccagcgc tgccctacaa ccacatctac tcgtacccca gccctatcac
      361 ggcggcggcc gccaaggtgc ccacgccacc cggggtgcct gccatccccg gttcggtggc
      421 catgccgcgc acctggccct cctcgcactc cgtcaccgac atcctgggca tccgctccat
      481 caccgaccaa gtgagcgaca gctcccccta ccacagcccc aaggtggagg agtggagcag
      541 cctgggccgc aacaacttcc ccgccgccgc cccgcacgcg gtgaacgggt tggagaaggg
      601 agccctggag caggaagcca agtacggtca ggcaccaaat ggtctcccag ctgtgggcag
      661 ttttgtgtca gcatccagca tggctcctta ccctacccca gcccaagtgt cgccttacat
      721 gacctacagt gctgctcctt ctggttatgt tgctggacat gggtggcaac atgctggggg
      781 cacctcattg tctccccaca actgtgacat tccggcatcg ctggcgttca agggaatgca
      841 ggcagccaga gaaggtagtc attctgtcac ggcttccgcg ctctgatggg aaattccgtc
      901 tccagcagct tcacccgggt ctccctgtct cagcacctcc tcccccaatt cccaggtctc
      961 acatcccacc cctcctgccc tccaaccctt ctgccttgaa agctggctgt acggactcac
     1021 atcctttgtg ctaatgacac ttacatattt cttgccataa cttttctctt gcagaaaaac
     1081 tgacatgact ttaggattta aaaccaagag caacaataag cattgaatga gacatttgtg
     1141 ttgcccacat actgtcttaa cataacaaag aaacctacac ccctcaaagg gtttaaggaa
     1201 ctttacaaac tagtctttgg taaaaccaca tgtgtatatt tattctaaat caacctgaac
     1261 ttttgaaatg tgcaattgtt gagattttgc aaaatcaata aaggaaaata cttttagaaa
     1321 aaattatgct acaccctcta atcaaatatg gtaaccaagt aagctttaat tcatcattag
     1381 gaaacaaatc aataagtgac ttgtttgagt gatcctttgt ttaagacatg acctattttg
     1441 ttgaaaaata tatgtagaac ccaagcaata tctgaatcta gctctccctg gtgttttgac
     1501 ttggttccaa atacaataat gtttatattt tctattagtt tgtaaatacg gactctggat
     1561 ggtgcatttg tgtcttcatt ccataagata ttcccctccc ctcagcccca ccccctctct
     1621 atttttttct ttcttttttg caaaggtgac tttctggcaa cgtctttgtc tctgtttggt
     1681 ggtgggctgc tcgggctcct ggatctggac ttgcccccaa attttgtgta tgcagtgaag
     1741 gcttcaacat ctcatgaagg acactttatt tctacagcag aggacacgaa aaacagataa
     1801 aacaagccag tctcccattt tgtacctaat caaacaacac acatgctaag catataaaga
     1861 caagagggtg gaaaatatct gaacaagaag gctctaaagg aagtcactta gaaacttaag
     1921 tttaatgtga aatgttttgc aaagatgctt aaaatgaact ttgtgttaag aaaaccactg
     1981 tgaaactaaa ttgtcctatt attgttggct tacctgtgtg ttcagcaatc tcagccccaa
     2041 ataatgttgt aatttaaaga aaatggaaaa ttctgctcta atgaatgtaa caatggcttg
     2101 ctgtgaagtt tacattgttg tacagaagca tgtttcgcat gtaggtaaac tggtggtggt
     2161 actagaaata caatgttatt t
//