LOCUS       WSU54571                 870 bp    mRNA    linear   VRL 31-JUL-1996
DEFINITION  Wheat streak mosaic virus strain OSU coat protein mRNA, partial
            cds.
ACCESSION   U54571
VERSION     U54571.1
KEYWORDS    .
SOURCE      Wheat streak mosaic virus
  ORGANISM  Wheat streak mosaic virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Potyviridae; Tritimovirus.
REFERENCE   1  (bases 1 to 870)
  AUTHORS   Sherwood,J.L., Chenault,K.D. and Hunger,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-1996) John L. Sherwood, Plant Pathology, Oklahoma
            State University, 110 NRC, Stillwater, OK 74078, USA
FEATURES             Location/Qualifiers
     source          1..870
                     /organism="Wheat streak mosaic virus"
                     /mol_type="mRNA"
                     /strain="OSU"
                     /db_xref="taxon:31741"
                     /map="870 nts from nts 398-1825, Niblett et al., 1991"
     CDS             <1..870
                     /codon_start=1
                     /product="coat protein"
                     /protein_id="AAB05235.1"
                     /translation="QSNNVSVMAGLDTGGTKTGQGSGSKGTSGSFVSNPVRTGGRATD
                     VQDQTPGLVFPAPKITTKAIYMPKTVRDKIKPEMINNMIKYQPRAELIDNRYATTEQL
                     NTWIEEVSEGLDVTEEVFINTLLPGWVYHCIINTTSPENRALGTWRVVNNAGKDNEQQ
                     LEFKIEPMYKAAKPSLRAIMRHFGEGARVTIEESVRIGKPIIPRGFDKAGVLSINNIV
                     AACDFIMRGADDTPNFVQVQNSVAVNRLRGIQNKLFAQARLSAGTNEDNSRHDADDVR
                     ENTHSFNGVNALA"
BASE COUNT          281 a          187 c          226 g          176 t
ORIGIN      
        1 caatctaata acgtatctgt catggctggc ctcgacacgg gaggaactaa gacaggtcaa
       61 ggatcaggat caaaagggac gagtggttca ttcgtatcga atcccgtgcg aactggaggc
      121 cgagcaacgg atgtgcaaga tcagacacca gggttagtgt ttccagcacc aaagatcaca
      181 acaaaggcca tatacatgcc aaaaactgta cgcgacaaga taaagcctga aatgataaat
      241 aacatgatca aataccaacc gcgtgcggaa cttatcgaca acagatatgc aacaactgaa
      301 cagctcaaca cctggataga agaggtatct gaagggcttg acgtgacaga ggaagttttc
      361 ataaacacct tacttccagg atgggtctac cactgcataa tcaacacaac gagcccagag
      421 aacagagcac taggaacttg gcgtgttgtg aataatgcag gcaaggacaa tgagcagcaa
      481 cttgagttta aaattgaacc gatgtacaaa gctgcgaagc catcacttcg agccattatg
      541 cgccactttg gtgaaggagc tcgagtgacg atcgaggaga gtgttcggat tggaaaacct
      601 atcataccaa ggggcttcga caaggccggt gtgctaagca tcaacaatat tgtggcagcg
      661 tgtgatttca ttatgcgcgg tgcagatgac acaccaaatt ttgtgcaagt gcagaacagc
      721 gttgcagtga acaggctacg cggaatacag aacaagctgt ttgcacaggc acgactgagt
      781 gcgggtacta atgaggacaa ctcacgtcat gatgcagatg atgtgaggga gaacacgcac
      841 agtttcaatg gtgtaaacgc tcttgcgtga
//