LOCUS       HSU48736                1718 bp    mRNA    linear   HUM 02-JUL-1996
DEFINITION  Human serine/threonine-protein kinase PRP4h (PRP4h) mRNA, complete
            cds.
ACCESSION   U48736
VERSION     U48736.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1718)
  AUTHORS   Luetzelberger,M., Schnell,B., Klingenhoff,A., Peter,C., Gross,T.,
            Shenoy,S. and Kaeufer,N.F.
  TITLE     Prp4, a kinase from the fission yeast, involved in pre-mRNA
            splicing and its mammalian homolog
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1718)
  AUTHORS   Luetzelberger,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-FEB-1996) Martin Luetzelberger, Genetics, Technical
            University Braunschweig, Spielmannstrasse 7, Braunschweig, 38106,
            Germany
FEATURES             Location/Qualifiers
     source          1..1718
                     /db_xref="H-InvDB:HIT000220067"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HeLa S3"
     gene            1..1718
                     /gene="PRP4h"
     CDS             114..1604
                     /gene="PRP4h"
                     /note="similar to S. pombe serine/threonine-protein kinase
                     PRP4: SwissProt Accession Number Q07538"
                     /codon_start=1
                     /product="serine/threonine-protein kinase PRP4h"
                     /protein_id="AAB03268.1"
                     /db_xref="GI:1399462"
                     /translation="MKVEQESSSDDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYL
                     AEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNL
                     MTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDA
                     EGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTG
                     LKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGL
                     HIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADND
                     ITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMD
                     LKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIG
                     CQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI"
BASE COUNT          584 a          305 c          383 g          446 t
ORIGIN      
        1 ggtcggagga gcagatcacg cttgcgaagg cggtctcgat cacgcggtgg tcgtagacga
       61 aggagcagaa gcaaagtaag gaagataaat ttaaaggaag tctttctgaa ggaatgaaag
      121 ttgagcagga atcttcgtct gatgataacc ttgaagactt tgatgtagag gaagaagatg
      181 aagaagccct aatagaacag agaagaatcc aaaggcaggc aattgttcag aaatataaat
      241 accttgctga agatagcaac atgtctgtgc catctgaacc aagcagcccc cagagcagta
      301 cgagaacacg atcaccatct ccagatgaca ttctggagcg agtagctgct gatgttaaag
      361 agtatgaacg ggaaaatgtt gatacatttg aggcctcagt gaaagccaag cataatctaa
      421 tgacagttga acagaataat ggttcatctc agaagaagtt gttggcacct gatatgttta
      481 cagaatctga tgatatgttt gctgcgtatt ttgatagtgc tcgtcttcgg gccgctggca
      541 ttggaaaaga tttcaaagag aatcccaacc tcagagataa ctggaccgat gcagaaggct
      601 attatcgtgt gaacataggt gaagtcctag ataaacgtta caatgtgtat ggctacactg
      661 ggcaaggtgt attcagtaat gttgtacgag ccagagataa tgcaagagcc aaccaagaag
      721 tggctgtaaa gatcatcaga aacaatgagc tcatgcaaaa gactggttta aaagaattag
      781 agttcttgaa aaagcttaat gatgctgatc ctgatgacaa atttcattgt ctgagactct
      841 tcaggcactt ctatcacaag cagcatcttt gtctggtatt cgagcctctc agcatgaact
      901 tacgagaggt gttaaaaaaa tatggtaaag atgttggtct tcatattaaa gctgtaagat
      961 cctatagtca gcagttgttc ctggcattga aactccttaa aagatgcaat atcctacatg
     1021 cagatatcaa gccagacaat atcctggtta atgaatccaa aactatttta aagctttgcg
     1081 attttgggtc ggcttcacat gttgcggata atgacataac accttatctt gtcagtagat
     1141 tttatcgtgc tcctgaaatc attataggta aaagctatga ctatggtata gatatgtggt
     1201 ctgtaggttg caccttatac gaactctata ctggaaaaat tttattccct ggcaaaacca
     1261 ataaccatat gctgaagctt gcaatggatc tcaaaggaaa gatgccaaat aagatgattc
     1321 gaaaaggtgt gttcaaagat cagcattttg atcaaaatct caacttcatg tacatagaag
     1381 ttgataaagt aacagagagg gagaaagtta ctgttatgag caccattaat ccaactaagg
     1441 acctgttggc tgacttgatt gggtgccaga gacttcctga agaccaacgt aagaaagtac
     1501 accagctaaa ggacttgttg gaccagattc tgatgttgga cccagctaaa cgaattagca
     1561 tcaaccaggc cctacagcac gccttcatcc aggaaaaaat ttaaacaaga tgaagaaact
     1621 ccaagggttt gagtaaatac aaagatgaag aaatttcaca gcagtttcat taatgtatat
     1681 aaacttataa atatttctcc agcaaatttg aggaagca
//