LOCUS       HSU43185                4279 bp    mRNA    linear   HUM 26-AUG-1996
DEFINITION  Human signal transducer and activator of transcription Stat5A mRNA,
            complete cds.
ACCESSION   U43185
VERSION     U43185.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4279)
  AUTHORS   Lin,J.X., Mietz,J., Modi,W.S., John,S. and Leonard,W.J.
  TITLE     Cloning of human Stat5B. Reconstitution of interleukin-2-induced
            Stat5A and Stat5B DNA binding activity in COS-7 cells
  JOURNAL   J. Biol. Chem. 271 (18), 10738-10744 (1996)
   PUBMED   8631883
REFERENCE   2  (bases 1 to 4279)
  AUTHORS   Lin,J.-X., Mietz,J., Modi,W.S., John,S. and Leonard,W.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-1995) Jian-Xin Lin, Laboratory of Molecular
            Immunology, NHLBI, NIH, 9000 Rockville Pike, Bldg. 10, Rm. 7N244,
            Bethesda, MD 20892, USA
FEATURES             Location/Qualifiers
     source          1..4279
                     /db_xref="H-InvDB:HIT000219834"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q11.2"
     CDS             641..3025
                     /note="signal transducer and activator of transcription;
                     Stat5A is activated by IL-2, IL-7, IL-15, IL-3, GM-CSF,
                     growth hormone, prolactin, erythropoietin and
                     thrombopoietin; activation and dimerization of Stat5A
                     requires phosphorylation of tyrosine 694"
                     /codon_start=1
                     /product="Stat5A"
                     /protein_id="AAB06589.1"
                     /db_xref="GI:1151170"
                     /translation="MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWD
                     AIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLRHYATQLQKTYDRCP
                     LELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTEN
                     ELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQRE
                     AQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQ
                     SWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFII
                     EKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNEC
                     SGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSV
                     GSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLC
                     EALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGW
                     NYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEI
                     GGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKY
                     YTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQ
                     NPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS"
BASE COUNT          920 a         1194 c         1291 g          874 t
ORIGIN      
        1 cagacaggat attcactgct gtggcaaggc ctgtagagag tttcgaagtt aggaggactc
       61 aagacggtcc ctccctggac ttttctgaag gggctcaaaa gatgacacgc gccagagctg
      121 gaaggcgtcg ccaattggtc caacttttcc ctcctccctt tttgcggatg agaaaaactg
      181 aggcccaggt ttgggatttc cagagcccgg gatttcccgg caacgccgac aaccacattc
      241 ccccggctat tctgacccgc cccggttccg ggacgctccc tgggagccgc cgccgagggc
      301 ctgctgggac tcccggggac cccgccgtcg gggcagcccc cacgcccggc gccgcccgcc
      361 ggaacggcgc cgctgttgcg cacttgcagg ggagccggcg actgagggcg aggcagggag
      421 ggagcaagcg gggctgggag ggctgctggc gcgggctcgc cggctgtgta tggtctatcg
      481 caggcagctg acctttgagg aggaaatcgc tgctctccgc tccttcctgt agtaacagcc
      541 gccgctgccg ccgccgccag gaacccggcc gggagcgaga gccgcggggc gcagagccgg
      601 cccggctgcc ggacggtgcg gccccaccag gtgaacggcc atggcgggct ggatccaggc
      661 ccagcagctg cagggagacg cgctgcgcca gatgcaggtg ctgtacggcc agcacttccc
      721 catcgaggtc cggcactact tggcccagtg gattgagagc cagccatggg atgccattga
      781 cttggacaat ccccaggaca gagcccaagc cacccagctc ctggagggcc tggtgcagga
      841 gctgcagaag aaggcggagc accaggtggg ggaagatggg tttttactga agatcaagct
      901 gaggcactac gccacgcagc tccagaaaac atatgaccgc tgccccctgg agctggtccg
      961 ctgcatccgg cacattctgt acaatgaaca gaggctggtc cgagaagcca acaattgcag
     1021 ctctccggct gggatcctgg ttgacgccat gtcccagaag caccttcaga tcaaccagac
     1081 atttgaggag ctgcgactgg tcacgcagga cacagagaat gagctgaaga aactgcagca
     1141 gactcaggag tacttcatca tccagtacca ggagagcctg aggatccaag ctcagtttgc
     1201 ccagctggcc cagctgagcc cccaggagcg tctgagccgg gagacggccc tccagcagaa
     1261 gcaggtgtct ctggaggcct ggttgcagcg tgaggcacag acactgcagc agtaccgcgt
     1321 ggagctggcc gagaagcacc agaagaccct gcagctgctg cggaagcagc agaccatcat
     1381 cctggatgac gagctgatcc agtggaagcg gcggcagcag ctggccggga acggcgggcc
     1441 ccccgagggc agcctggacg tgctacagtc ctggtgtgag aagttggccg agatcatctg
     1501 gcagaaccgg cagcagatcc gcagggctga gcacctctgc cagcagctgc ccatccccgg
     1561 cccagtggag gagatgctgg ccgaggtcaa cgccaccatc acggacatta tctcagccct
     1621 ggtgaccagc acattcatca ttgagaagca gcctcctcag gtcctgaaga cccagaccaa
     1681 gtttgcagcc accgtacgcc tgctggtggg cgggaagctg aacgtgcaca tgaatccccc
     1741 ccaggtgaag gccaccatca tcagtgagca gcaggccaag tctctgctta aaaatgagaa
     1801 cacccgcaac gagtgcagtg gtgagatcct gaacaactgc tgcgtgatgg agtaccacca
     1861 agccacgggc accctcagtg cccacttcag gaacatgtca ctgaagagga tcaagcgtgc
     1921 tgaccggcgg ggtgcagagt ccgtgacaga ggagaagttc acagtcctgt ttgagtctca
     1981 gttcagtgtt ggcagcaatg agcttgtgtt ccaggtgaag actctgtccc tacctgtggt
     2041 tgtcatcgtc cacggcagcc aggaccacaa tgccacggct actgtgctgt gggacaatgc
     2101 ctttgctgag ccgggcaggg tgccatttgc cgtgcctgac aaagtgctgt ggccgcagct
     2161 gtgtgaggcg ctcaacatga aattcaaggc cgaagtgcag agcaaccggg gcctgaccaa
     2221 ggagaacctc gtgttcctgg cgcagaaact gttcaacaac agcagcagcc acctggagga
     2281 ctacagtggc ctgtccgtgt cctggtccca gttcaacagg gagaacttgc cgggctggaa
     2341 ctacaccttc tggcagtggt ttgacggggt gatggaggtg ttgaagaagc accacaagcc
     2401 ccactggaat gatggggcca tcctaggttt tgtgaataag caacaggccc acgacctgct
     2461 catcaacaag cccgacggga ccttcttgtt gcgctttagt gactcagaaa tcgggggcat
     2521 caccatcgcc tggaagtttg attccccgga acgcaacctg tggaacctga aaccattcac
     2581 cacgcgggat ttctccatca ggtccctggc tgaccggctg ggggacctga gctatctcat
     2641 ctatgtgttt cctgaccgcc ccaaggatga ggtcttctcc aagtactaca ctcctgtgct
     2701 ggctaaagct gttgatggat atgtgaaacc acagatcaag caagtggtcc ctgagtttgt
     2761 gaatgcatct gcagatgctg ggggcagcag cgccacgtac atggaccagg ccccctcccc
     2821 agctgtgtgc ccccaggctc cctataacat gtacccacag aaccctgacc atgtactcga
     2881 tcaggatgga gaattcgacc tggatgagac catggatgtg gccaggcacg tggaggaact
     2941 cttacgccga ccaatggaca gtcttgactc ccgcctctcg ccccctgccg gtcttttcac
     3001 ctctgccaga ggctccctct catgaatgtt tgaatcccac gcttctcttt ggaaacaata
     3061 tgcaatgtga agcggtcgtg ttgtgagttt agtaaggctg tgtacactga cacctttgca
     3121 ggcatgcatg tgcttgtgtg tgtgtgtgtg tgtccttgcg catgagctac gcctgcctcc
     3181 cctgtgccag tcctgggatg tggctgcagc agcggtggcc ggcctctttt cagatcatgg
     3241 catccaagag tgcgccgagt ctgtctctgt catggtagag accgagcctc tgtcactgca
     3301 ggcactcaat gcagccagac ctattcctcc tgtgcccctc atctgctcag cagctatttg
     3361 aatgagatga ttcagaaggg gaggggagac aggtaacgtc tgtaagctga agtttcactc
     3421 cggagtgaga agctttgccc tcctaagaga gagagacaga gagacagaga gagagaaaga
     3481 gagagtgtgt gggtctatgt aaatgcatct gtcctcatgt gttgatgtaa ccgattcatc
     3541 tctcagaagg gaggctgggg ttcattttcg agtagtattt tatactttag tgaacgtgga
     3601 ctccagactc tctgtgaacc ctatgagagc gcgtctgggc ccggccatgt ccttagcaca
     3661 ggggggccgc cggtttgagt gagggtttct gagctgctct gaattagtcc ttgcttggct
     3721 gcttggcctt gggttcattc aagctcacga tgctgttccc acgtttcccg ggatatatat
     3781 tctctcccct ccgttgggcc ccagccttct ttgcttgcct ctctgtttgt aaccttgtcg
     3841 acaaagaggt agaaaagatt gggtctagga tatggtgggt ggacaggggc cccgggactt
     3901 ggagggttgg tcctcttgcc tcctggaaaa aacaaaaaca aaaaactgca gtgaaagaca
     3961 agctgcaaat cagccatgtg ctgcgtgcct gtggaatctg gagtgagggg taaaagctga
     4021 tctggtttga ctccgctgga ggtggggcct ggagcaggcc ttgcgctgtt gcgtaactgg
     4081 ctgtgttctg gtgaggcctt gctcccaacc ccacacgctc ctccctctga ggcgtgagga
     4141 ctcgcagtca ggggcagctg accatggaag attgagagcc caaggtttaa acttcttctc
     4201 tgaagggagg tggggatgag aagaggggtt tttttgtact ttgtacaaag accacacatt
     4261 tgtgtaaaca gtgttttgg
//