LOCUS       HSU38545                3609 bp    mRNA    linear   HUM 10-MAR-1997
DEFINITION  Human ARF-activated phosphatidylcholine-specific phospholipase D1a
            (hPLD1) mRNA, complete cds.
ACCESSION   U38545
VERSION     U38545.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3609)
  AUTHORS   Hammond,S.M., Altshuller,Y.M., Sung,T.C., Rudge,S.A., Rose,K.,
            Engebrecht,J., Morris,A.J. and Frohman,M.A.
  TITLE     Human ADP-ribosylation factor-activated
            phosphatidylcholine-specific phospholipase D defines a new and
            highly conserved gene family
  JOURNAL   J. Biol. Chem. 270 (50), 29640-29643 (1995)
   PUBMED   8530346
REFERENCE   2  (bases 1 to 3609)
  AUTHORS   Hammond,S.M. and Frohman,M.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-OCT-1995) Michael A. Frohman, Pharmacology, SUNY
            Stony Brook, BST, T7-172, Stony Brook, NY 11794-8651, USA
COMMENT     On Feb 16, 1996 this sequence version replaced gi:1125738.
FEATURES             Location/Qualifiers
     source          1..3609
                     /db_xref="H-InvDB:HIT000219594"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3q21.1-28"
                     /note="Cloned from HeLa cell library."
     gene            1..3609
                     /gene="hPLD1"
     CDS             96..3320
                     /gene="hPLD1"
                     /function="Cleaves phosphatidylcholine to phosphatidic
                     acid and choline"
                     /note="PLD1a; phosphatidylcholine-specific; activated by
                     PIP2, ARF; inhibited by oleate; membrane associated"
                     /codon_start=1
                     /product="phospholipase D1a"
                     /protein_id="AAB49031.1"
                     /db_xref="GI:1185463"
                     /translation="MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDV
                     SPSDPKIQEVYIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINL
                     YTIELTHGEFKWQVKRKFKHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREM
                     PSLPRSSENMIREEQFLGRRKQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLG
                     PKGIEGMIMKRSGGHRIPGLNCCGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVL
                     LVDKEFKIKVGKKETETKYGIRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNF
                     LKDHRFGSYAAIQENALAKWYVNAKGYFEDVANAMEEANEEIFITDWWLSPEIFLKRP
                     VVEGNRWRLDCILKRKAQQGVRIFIMLYKEVELALGINSEYTKRTLMRLHPNIKVMRH
                     PDHVSSTVYLWAHHEKLVIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGPS
                     LGSLPPAAMESMESLRLKDKNEPVQNLPIQKSIDDVDSKLKGIGKPRKFSKFSLYKQL
                     HRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGLKPHFKLFHPSSESEQGLTRPHADT
                     GSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIA
                     SAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLLPKSQTTAHELRYQVPGSVHA
                     NVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIENQFFISCADDKVVFNKIG
                     DAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGENS
                     ILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANI
                     NDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSE
                     DIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDP
                     IRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT"
BASE COUNT         1085 a          791 c          837 g          896 t
ORIGIN      
        1 ggcacgagga gccctgagag tccgccgcca acgcgcaggt gctagcggcc ccttcgccct
       61 gcagcccctt tgcttttact ctgtccaaag ttaacatgtc actgaaaaac gagccacggg
      121 taaatacctc tgcactgcag aaaattgctg ctgacatgag taatatcata gaaaatctgg
      181 acacgcggga actccacttt gagggagagg aggtagacta cgacgtgtct cccagcgatc
      241 ccaagataca agaagtgtat atccctttct ctgctattta taacactcaa ggatttaagg
      301 agcctaatat acagacgtat ctctccggct gtccaataaa agcacaagtt ctggaagtgg
      361 aacgcttcac atctacaaca agggtaccaa gtattaatct ttacactatt gaattaacac
      421 atggggaatt taaatggcaa gttaagagga aattcaagca ttttcaagaa tttcacagag
      481 agctgctcaa gtacaaagcc tttatccgca tccccattcc cactagaaga cacacgttta
      541 ggaggcaaaa cgtcagagag gagcctcgag agatgcccag tttgccccgt tcatctgaaa
      601 acatgataag agaagaacaa ttccttggta gaagaaaaca actggaagat tacttgacaa
      661 agatactaaa aatgcccatg tatagaaact atcatgccac aacagagttt cttgatataa
      721 gccagctgtc tttcatccat gatttgggac caaagggcat agaaggtatg ataatgaaaa
      781 gatctggagg acacagaata ccaggcttga attgctgtgg tcagggaaga gcctgctaca
      841 gatggtcaaa aagatggtta atagtgaaag attccttttt attgtatatg aaaccagaca
      901 gcggtgccat tgccttcgtc ctgctggtag acaaagaatt caaaattaag gtggggaaga
      961 aggagacaga aacgaaatat ggaatccgaa ttgataatct ttcaaggaca cttattttaa
     1021 aatgcaacag ctatagacat gctcggtggt ggggaggggc tatagaagaa ttcatccaga
     1081 aacatggcac caactttctc aaagatcatc gatttgggtc atatgctgct atccaagaga
     1141 atgctttagc taaatggtat gttaatgcca aaggatattt tgaagatgtg gcaaatgcaa
     1201 tggaagaggc aaatgaagag atttttatca cagactggtg gctgagtcca gaaatcttcc
     1261 tgaaacgccc agtggttgag ggaaatcgtt ggaggttgga ctgcattctt aaacgaaaag
     1321 cacaacaagg agtgaggatc ttcataatgc tctacaaaga ggtggaactc gctcttggca
     1381 tcaatagtga atacaccaag aggactttga tgcgtctaca tcccaacata aaggtgatga
     1441 gacacccgga tcatgtgtca tccaccgtct atttgtgggc tcaccatgag aagcttgtca
     1501 tcattgacca atcggtggcc tttgtgggag ggattgacct ggcctatgga aggtgggacg
     1561 acaatgagca cagactcaca gacgtgggca gtgtgaagcg ggtcacttca ggaccgtctc
     1621 tgggttccct cccacctgcc gcaatggagt ctatggaatc cttaagactc aaagataaaa
     1681 atgagcctgt tcaaaaccta cccatccaga agagtattga tgatgtggat tcaaaactga
     1741 aaggaatagg aaagccaaga aagttctcca aatttagtct ctacaagcag ctccacaggc
     1801 accacctgca cgacgcagat agcatcagca gcattgacag cacctccagt tattttaatc
     1861 actatagaag tcatcacaat ttaatccatg gtttaaaacc ccacttcaaa ctctttcacc
     1921 cgtccagtga gtctgagcaa ggactcacta gacctcatgc tgataccggg tccatccgta
     1981 gtttacagac aggtgtggga gagctgcatg gggaaaccag attctggcat ggaaaggact
     2041 actgcaattt cgtcttcaaa gactgggttc aacttgataa accttttgct gatttcattg
     2101 acaggtactc cacgccccgg atgccctggc atgacattgc ctctgcagtc cacgggaagg
     2161 cggctcgtga tgtggcacgt cacttcatcc agcgctggaa cttcacaaaa attatgaaat
     2221 caaaatatcg gtccctttct tatccttttc tgcttccaaa gtctcaaaca acagcccatg
     2281 agttgagata tcaagtgcct gggtctgtcc atgctaacgt acagttgctc cgctctgctg
     2341 ctgattggtc tgctggtata aagtaccatg aagagtccat ccacgccgct tacgtccatg
     2401 tgatagagaa cagcaggcac tatatctata tcgaaaacca gtttttcata agctgtgctg
     2461 atgacaaagt tgtgttcaac aagataggcg atgccattgc ccagaggatc ctgaaagctc
     2521 acagggaaaa ccagaaatac cgggtatatg tcgtgatacc acttctgcca gggttcgaag
     2581 gagacatttc aaccggcgga ggaaatgctc tacaggcaat catgcacttc aactacagaa
     2641 ccatgtgcag aggagaaaat tccatccttg gacagttaaa agcagagctt ggtaatcagt
     2701 ggataaatta catatcattc tgtggtctta gaacacatgc agagctcgaa ggaaacctag
     2761 taactgagct tatctatgtc cacagcaagt tgttaattgc tgatgataac actgttatta
     2821 ttggctctgc caacataaat gaccgcagca tgctgggaaa gcgtgacagt gaaatggctg
     2881 tcattgtgca agatacagag actgttcctt cagtaatgga tggaaaagag taccaagctg
     2941 gccggtttgc ccgaggactt cggctacagt gctttagggt tgtccttggc tatcttgatg
     3001 acccaagtga ggacattcag gatccagtga gtgacaaatt cttcaaggag gtgtgggttt
     3061 caacagcagc tcgaaatgct acaatttatg acaaggtttt ccggtgcctt cccaatgatg
     3121 aagtacacaa tttaattcag ctgagagact ttataaacaa gcccgtatta gctaaggaag
     3181 atcccattcg agctgaggag gaactgaaga agatccgtgg atttttggtg caattcccct
     3241 tttatttctt gtctgaagaa agcctactgc cttctgttgg gaccaaagag gccatagtgc
     3301 ccatggaggt ttggacttaa gagatattca ttggcagctc aaagacttcc accctggaga
     3361 ccacactgca cacagtgact tcctggggat gtcatagcca aagccaggcc tgacgcattc
     3421 tcgtatccaa cccaaggacc ttttggaatg actggggagg gctgcagtca cattgatgta
     3481 aggactgtaa acatcagcaa gactttataa ttccttctgc ctaacttgta aaaagggggc
     3541 tgcattcttg ttggtagcat gtactctgtt gagtaaaaca catattcaaa ttccgctcgt
     3601 gccgaattc
//