LOCUS       HSU34976                1630 bp    mRNA    linear   HUM 08-NOV-1995
DEFINITION  Human gamma-sarcoglycan mRNA, complete cds.
ACCESSION   U34976
VERSION     U34976.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1630)
  AUTHORS   Noguchi,S., McNally,E.M., Othmane,K.B., Hagiwara,Y., Mizuno,Y.,
            Yoshida,M., Yamamoto,H., Bonnemann,C.G., Gussoni,E., Denton,P.H.,
            Kyriakides,T., Middleton,L., Hentati,F., Hamida,M.B., Nonaka,I.,
            Vance,J.M., Kunkel,L.M. and Ozawa,E.
  TITLE     Mutations in the dystrophin-associated protein gamma-sarcoglycan in
            chromosome 13 muscular dystrophy
  JOURNAL   Science 270 (5237), 819-822 (1995)
   PUBMED   7481775
REFERENCE   2  (bases 1 to 1630)
  AUTHORS   McNally,E.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-1995) Elizabeth M. McNally, Genetics, Children's
            Hospital, 300 Longwood, Boston, MA 02115, USA
FEATURES             Location/Qualifiers
     source          1..1630
                     /db_xref="H-InvDB:HIT000219403"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q12"
     CDS             125..1000
                     /note="mutated in SCARMD (LGMD 2C); 35 kDa
                     dystrophin-associated protein"
                     /codon_start=1
                     /product="gamma-sarcoglycan"
                     /protein_id="AAC50269.1"
                     /db_xref="GI:1054903"
                     /translation="MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLL
                     IILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSS
                     LLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVV
                     GTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKI
                     EALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSV
                     AGVSTTCQEHSHICL"
BASE COUNT          446 a          350 c          386 g          448 t
ORIGIN      
        1 gttgctgaag cttcatcctt tgctctcatt ctgtaagtca tagaaaagtt tgaaacattc
       61 tgtctgtggt agagctcggg ccagctgtag ttcattcgcc agtgtgcttt tcttaatatc
      121 taagatggtg cgtgagcagt acactacagc cacagaaggc atctgcatag agaggccaga
      181 gaatcagtat gtctacaaaa ttggcattta tggctggaga aagcgctgtc tctacttgtt
      241 tgttcttctt ttactcatca tcctcgttgt gaatttagct cttacaattt ggattcttaa
      301 agtgatgtgg ttttctccag caggaatggg ccacttgtgt gtaacaaaag atggactgcg
      361 cttggaaggg gaatcagaat ttttattccc attgtatgcc aaagaaatac actccagagt
      421 ggactcatct ctgctgctac aatcaaccca gaatgtgact gtaaatgcgc gcaactcaga
      481 aggggaggtc acaggcaggt taaaagtcgg tcccaaaatg gtagaagtcc agaatcaaca
      541 gtttcagatc aactccaacg acggcaagcc actatttact gtagatgaga aggaagttgt
      601 ggttggtaca gataaacttc gagtaactgg gcctgaaggg gctctttttg aacattcagt
      661 ggagacaccc cttgtcagag ccgacccgtt tcaagacctt agattagaat cccccactcg
      721 gagtctaagc atggatgccc caaggggtgt gcatattcaa gctcacgctg ggaaaattga
      781 ggcgctttct caaatggata ttctttttca tagtagtgat ggaatgcttg tgcttgatgc
      841 tgaaactgtg tgcttaccca agctggtgca ggggacgtgg ggtccctctg gcagctcaca
      901 gagcctctac gaaatctgtg tgtgtccaga tgggaagctg tacctgtctg tggccggtgt
      961 gagcaccacg tgccaggagc acagccacat ctgcctctga gctgcctgcg tcctctcggt
     1021 gagctgtgca gtgccggccc cagatcctca cacccaggga gcagctgcac atcgtgaaag
     1081 actgaggcag cgtggatggg aagtaaacgc ttccagagga actcagaaaa aattatgtgc
     1141 cagtgaaagt gtttggacaa aaactacatg atctcaaaat gcacgtggat gtgagacaca
     1201 aaagttgaca aaatggaaaa gcaatgtgtt tttccactgg attaattttc accggaacaa
     1261 ttgcgaattc tctctgcctc gcctccccct atcttgtccg tgtgggcaca cactgagtgt
     1321 tgagttgccg tgtggagtta atgtatgacg ctccactgtg gatatctaat gccctgttga
     1381 gagtagcctt gctcagtact aaaatgcccc aaagttctat acagcatttc ctttatagca
     1441 ttcaaacctc acatcctccc ttcagtttaa tgcaagtaag tcaggtttca caagaaaatt
     1501 ttcaagtttt gaagggaatt tgaggttgat ctggttttca agatgtagtt aaaggaataa
     1561 atcactcaaa attaaacttt ctgtatatag tcaataagca ataaaaacct catttttcag
     1621 agttaaaaaa
//