LOCUS       HSU28964                1030 bp    mRNA    linear   HUM 23-MAR-1998
DEFINITION  Homo sapiens 14-3-3 protein mRNA, complete cds.
ACCESSION   U28964
VERSION     U28964.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1030)
  AUTHORS   Seluja,G.A., Elias,L. and Pietromonaco,S.F.
  TITLE     Two unique 5' untranslated regions in mRNAs encoding human 14-3-3
            zeta: differential expression in hemopoietic cells
  JOURNAL   Biochim. Biophys. Acta 1395 (3), 281-287 (1998)
   PUBMED   9512661
REFERENCE   2  (bases 1 to 1030)
  AUTHORS   Seluja,G.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUN-1995) Gustavo A. Seluja, University of New
            Mexico, Cell Biology, 900 Camino de Salud, NE, Albuquerque, NM
            87131, USA
FEATURES             Location/Qualifiers
     source          1..1030
                     /db_xref="H-InvDB:HIT000218943"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="hBM5"
                     /tissue_type="bone marrow"
     regulatory      123..130
                     /regulatory_class="other"
                     /note="Kozak sequence"
     CDS             127..864
                     /codon_start=1
                     /product="14-3-3 protein"
                     /protein_id="AAC52052.1"
                     /db_xref="GI:899459"
                     /translation="MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLL
                     SVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLE
                     KFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM
                     QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIM
                     QLLRDNLTLWTSDTQGDEAEAGEGGEN"
BASE COUNT          309 a          222 c          242 g          257 t
ORIGIN      
        1 gcctgtgagc agcgagatcc agggacagag tctcagcctc gccgctgctg ccgccgccgc
       61 cgcccagaga ctgctgagcc cgtccgtccg ccgccaccac ccactccgga cacagaacat
      121 ccagtcatgg ataaaaatga gctggttcag aaggccaaac tggccgagca ggctgagcga
      181 tatgatgaca tggcagcctg catgaagtct gtaactgagc aaggagctga attatccaat
      241 gaggagagga atcttctctc agttgcttat aaaaatgttg taggagcccg taggtcatct
      301 tggagggtcg tctcaagtat tgaacaaaag acggaaggtg ctgagaaaaa acagcagatg
      361 gctcgagaat acagagagaa aattgagacg gagctaagag atatctgcaa tgatgtactg
      421 tctcttttgg aaaagttctt gatccccaat gcttcacaag cagagagcaa agtcttctat
      481 ttgaaaatga aaggagatta ctaccgttac ttggctgagg ttgccgctgg tgatgacaag
      541 aaagggattg tcgatcagtc acaacaagca taccaagaag cttttgaaat cagcaaaaag
      601 gaaatgcaac caacacatcc tatcagactg ggtctggccc ttaacttctc tgtgttctat
      661 tatgagattc tgaactcccc agagaaagcc tgctctcttg caaagacagc ttttgatgaa
      721 gccattgctg aacttgatac attaagtgaa gagtcataca aagacagcac gctaataatg
      781 caattactga gagacaactt gacattgtgg acatcggata cccaaggaga cgaagctgaa
      841 gcaggagaag gaggggaaaa ttaaccggcc ttccaacttt tgtctgcctc attctaaaat
      901 ttacacagta gaccatttgt catccatgct gtcccacaaa tagttttttg tttacgattt
      961 atgacaggtt tatgttactt ctatttgaat ttctatattt cccatgtggt ttttatgttt
     1021 aatattaggg
//