LOCUS       HSU23731                1245 bp    mRNA    linear   HUM 18-JUL-1995
DEFINITION  Human TAR DNA-binding protein-43 mRNA, complete cds.
ACCESSION   U23731
VERSION     U23731.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1245)
  AUTHORS   Ou,S.H., Wu,F., Harrich,D., Garcia-Martinez,L.F. and Gaynor,R.B.
  TITLE     Cloning and characterization of a novel cellular protein, TDP-43,
            that binds to human immunodeficiency virus type 1 TAR DNA sequence
            motifs
  JOURNAL   J. Virol. 69 (6), 3584-3596 (1995)
   PUBMED   7745706
REFERENCE   2  (bases 1 to 1245)
  AUTHORS   Ou,S.-H.I.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAR-1995) S.-H.I. Ou, Internal Medicine, University
            of Texas Southwestern, 5323 Harry Hines Blvd., Dallas, TX 75209,
            USA
FEATURES             Location/Qualifiers
     source          1..1245
                     /db_xref="H-InvDB:HIT000218701"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HeLa cells"
     CDS             1..1245
                     /note="TDP-43 binds to HIV-1 LTR TAR DNA region and can
                     repress HIV-1 transcription; TDP-43"
                     /codon_start=1
                     /product="TAR DNA-binding protein-43"
                     /protein_id="AAA70033.1"
                     /db_xref="GI:901998"
                     /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYR
                     NPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQK
                     TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVK
                     VMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVM
                     DVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRF
                     GGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSW
                     GMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAG
                     SGSGFNGGFGSSMDSKSSGWGM"
BASE COUNT          352 a          227 c          359 g          307 t
ORIGIN      
        1 atgtctgaat atattcgggt aaccgaagat gagaacgatg agcccattga aataccatcg
       61 gaagacgatg ggacggtgct gctctccacg gttacagccc agtttccagg ggcgtgtggg
      121 cttcgctaca ggaatccagt gtctcagtgt atgagaggtg tccggctggt agaaggaatt
      181 ctgcatgccc cagatgctgg ctggggaaat ctggtgtatg ttgtcaacta tccaaaagat
      241 aacaaaagaa aaatggatga gacagatgct tcatcagcag tgaaagtgaa aagagcagtc
      301 cagaaaacat ccgatttaat agtgttgggt ctcccatgga aaacaaccga acaggacctg
      361 aaagagtatt ttagtacctt tggagaagtt cttatggtgc aggtcaagaa agatcttaag
      421 actggtcatt caaaggggtt tggctttgtt cgttttacgg aatatgaaac acaagtgaaa
      481 gtaatgtcac agcgacatat gatagatgga cgatggtgtg actgcaaact tcctaattct
      541 aagcaaagcc aagatgagcc tttgagaagc agaaaagtgt ttgtggggcg ctgtacagag
      601 gacatgactg aggatgagct gcgggagttc ttctctcagt acggggatgt gatggatgtc
      661 ttcatcccca agccattcag ggcctttgcc tttgttacat ttgcagatga tcagattgcg
      721 cagtctcttt gtggagagga cttgatcatt aaaggaatca gcgttcatat atccaatgcc
      781 gaacctaagc acaatagcaa tagacagtta gaaagaagtg gaagatttgg tggtaatcca
      841 ggtggctttg ggaatcaggg tggatttggt aatagcagag ggggtggagc tggtttggga
      901 aacaatcaag gtagtaatat gggtggtggg atgaactttg gtgcgttcag cattaatcca
      961 gccatgatgg ctgccgccca ggcagcacta cagagcagtt ggggtatgat gggcatgtta
     1021 gccagccagc agaaccagtc aggcccatcg ggtaataacc aaaaccaagg caacatgcag
     1081 agggagccaa accaggcctt cggttctgga aataactctt atagtggctc taattctggt
     1141 gcagcaattg gttggggatc agcatccaat gcagggtcgg gcagtggttt taatggaggc
     1201 tttggctcaa gcatggattc taagtcttct ggctggggaa tgtag
//