LOCUS       HSU21247               11954 bp    RNA     linear   VRL 26-JUL-2016
DEFINITION  Human spumaretrovirus complete genome.
ACCESSION   U21247
VERSION     U21247.1
KEYWORDS    gag protein; long terminal repeat; pol polyprotein.
SOURCE      Human spumaretrovirus
  ORGANISM  Human spumaretrovirus
            Viruses; Retro-transcribing viruses; Retroviridae;
            Spumaretrovirinae; Spumavirus.
REFERENCE   1  (bases 9435 to 10337)
  AUTHORS   Flugel,R.M., Rethwilm,A., Maurer,B. and Darai,G.
  TITLE     Nucleotide sequence analysis of the env gene and its flanking
            regions of the human spumaretrovirus reveals two novel genes
  JOURNAL   EMBO J. 6 (7), 2077-2084 (1987)
   PUBMED   2820721
  REMARK    Erratum:[EMBO J 1990 Nov;9(11):3806]
REFERENCE   2  (bases 5337 to 11954)
  AUTHORS   Maurer,B., Bannert,H., Rethwilm,A., Darai,G. and Fluegel,R.M.
  TITLE     Characterization of the ENV gene and of two novel coding regions of
            the human spumaretrovirus
  JOURNAL   (in) Bolognesi,D.P. (Ed.);
            HUMAN RETROVIRUSES, CANCER AND AIDS: 75-88;
            Alan Liss, Inc., New York (1988)
REFERENCE   3  (bases 1 to 5342)
  AUTHORS   Maurer,B., Bannert,H., Darai,G. and Flugel,R.M.
  TITLE     Analysis of the primary structure of the long terminal repeat and
            the gag and pol genes of the human spumaretrovirus
  JOURNAL   J. Virol. 62 (5), 1590-1597 (1988)
   PUBMED   2451755
REFERENCE   4  (bases 1 to 11954)
  AUTHORS   Muranyi,W. and Flugel,R.M.
  TITLE     Analysis of splicing patterns of human spumaretrovirus by
            polymerase chain reaction reveals complex RNA structures
  JOURNAL   J. Virol. 65 (2), 727-735 (1991)
   PUBMED   1846194
REFERENCE   5  (bases 1 to 11954)
  AUTHORS   Lochelt,M., Zentgraf,H. and Flugel,R.M.
  TITLE     Construction of an infectious DNA clone of the full-length human
            spumaretrovirus genome and mutagenesis of the bel 1 gene
  JOURNAL   Virology 184 (1), 43-54 (1991)
   PUBMED   1651600
REFERENCE   6  (bases 1 to 11954)
  AUTHORS   Lochelt,M., Muranyi,W. and Flugel,R.M.
  TITLE     Human foamy virus genome possesses an internal, Bel-1-dependent and
            functional promoter
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (15), 7317-7321 (1993)
   PUBMED   8394017
REFERENCE   7  (bases 1 to 11954)
  AUTHORS   Weissenberger,J. and Flugel,R.M.
  TITLE     Identification and characterization of the Bel 3 protein of human
            foamy virus
  JOURNAL   AIDS Res. Hum. Retroviruses 10 (5), 595-600 (1994)
   PUBMED   7917520
REFERENCE   8  (bases 1 to 11954)
  AUTHORS   Kogel,D., Aboud,M. and Flugel,R.M.
  TITLE     Mutational analysis of the reverse transcriptase and ribonuclease H
            domains of the human foamy virus
  JOURNAL   Nucleic Acids Res. 23 (14), 2621-2625 (1995)
   PUBMED   7544460
REFERENCE   9  (bases 1 to 11954)
  AUTHORS   Lochelt,M. and Flugel,R.M.
  TITLE     The human foamy virus pol gene is expressed as a Pro-Pol
            polyprotein and not as a Gag-Pol fusion protein
  JOURNAL   J. Virol. 70 (2), 1033-1040 (1996)
   PUBMED   8551561
REFERENCE   10  (bases 1 to 11954)
  AUTHORS   Bodem,J., Lochelt,M., Winkler,I., Flower,R.P., Delius,H. and
            Flugel,R.M.
  TITLE     Characterization of the spliced pol transcript of feline foamy
            virus: the splice acceptor site of the pol transcript is located in
            gag of foamy viruses
  JOURNAL   J. Virol. 70 (12), 9024-9027 (1996)
   PUBMED   8971036
  REMARK    Erratum:[J Virol 1997 Nov;71(11):8952]
REFERENCE   11  (bases 1 to 11954)
  AUTHORS   Fluegel,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-1995) Rolf M. Fluegel, Abtlg. Retroviral Gene
            Expression, DKFZ-ATZ, Heidelberg 69009, Germany
FEATURES             Location/Qualifiers
     source          1..11954
                     /organism="Human spumaretrovirus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:11963"
                     /clone="pHSRV13, infectious"
     repeat_region   1..1121
                     /note="5' long terminal repeat"
                     /rpt_type=long_terminal_repeat
     repeat_region   1..11
                     /rpt_type=inverted
     protein_bind    265..271
                     /bound_moiety="AP-1"
     protein_bind    320..326
                     /bound_moiety="AP-1"
     regulatory      749..754
                     /regulatory_class="TATA_box"
     prim_transcript 778..11800
                     /note="gag gene"
                     /citation=[4]
                     /citation=[9]
                     /citation=[10]
     prim_transcript join(778..829,829..6451,6493..11800)
                     /note="secondary transcript"
                     /citation=[4]
                     /citation=[9]
                     /citation=[10]
     misc_feature    778
                     /note="start site of transcription; gag-pol-env genes"
     repeat_region   780..968
                     /note="LTR R-region"
     misc_feature    829
                     /note="major 5' splice donor site for all subgenomic
                     transcripts including pol, env, bel, and bet genes"
     repeat_region   1111..1121
                     /note="3' LTR"
                     /rpt_type=inverted
     misc_binding    1124..1141
                     /bound_moiety="Lys-tRNA 1 and 2 primer"
     gene            1223..3169
                     /gene="gag"
     CDS             1223..3169
                     /gene="gag"
                     /note="matrix protein; 78 kDa form"
                     /codon_start=1
                     /product="gag protein precursor"
                     /protein_id="AAB48111.1"
                     /translation="MASGSNVEEYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGW
                     WGQIERFQMVRLILQDDDNEPLQRPRYEVIQRAVNPHTMFMISGPLAELQLAFQDLDL
                     PEGPLRFGPLANGHYVQGDPYSSSYRPVTMAETAQMTRDELEDVLNTQSEIEIQMINL
                     LELYEVETRALRRQLAERSSTGQGGISPGAPRSRPPVSSFSGLPSLPSIPGIHPRAPS
                     PPRATSTPGNIPWSLGDDSPPSSSFPGPSQPRVSFHPGNPFVEEEGHRPRSQSRERRR
                     EILPAPVPSAPPMIQYIPVPPPPPIGTVIPIQHIRSVTGEPPRNPREIPIWLGRNAPA
                     IDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLG
                     NVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDNQ
                     TRAETFIQHLNAVYEILGLNARGQSIRASVTPQPRPSRGRGRGQNTSRPSQGPANSGR
                     GRQRPASGQSNRGSSTQNQNQDNLNQGGYNLRPRTYQPQRYGGGRGRRWNDNTNNQES
                     RPSDQGSQTPRPNQAGSGVRGNQSQTPRPAAGRGGRGNHNRNQRSSGAGDSRAVNTVT
                     QSATSSTDESSSAVTAASGGDQRD"
     mat_peptide     1832..3166
                     /gene="gag"
                     /product="gag protein"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="74 kDa form"
     misc_feature    1223..1831
                     /gene="gag"
                     /note="encodes matrix protein of the gag protein"
     misc_feature    <1616..3166
                     /gene="gag"
                     /note="encodes gag precursor, 74 kDa form including matrix
                     protein (MA); capsid antigen (CA); nucleocapsid protein
                     (NC), putative 3 kDa"
     CDS             <3117..6548
                     /citation=[10]
                     /codon_start=1
                     /product="pro-pol protein"
                     /protein_id="AAB48112.1"
                     /translation="MNPLQLLQPLPAEIKGTKLLAHWDSGATITCIPESFLEDEQPIK
                     KTLIKTIHGEKQQNVYYVTFKVKGRKVEAEVIASPYEYILLSPTDVPWLTQQPLQLTI
                     LVPLQEYQEKILSKTALPEDQKQQLKTLFVKYDNLWQHWENQVGHRKIRPHNIATGDY
                     PPRPQKQYPINPKAKPSIQIVIDDLLKQGVLTPQNSTMNTPVYPVPKPDGRWRMVLDY
                     REVNKTIPLTAAQNQHSAGILATIVRQKYKTTLDLANGFWAHPITPESYWLTAFTWQG
                     KQYCWTRLPQGFLNSPALFTADVVDLLKEIPNVQVYVDDIYLSHDDPKEHVQQLEKVF
                     QILLQAGYVVSLKKSEIGQKTVEFLGFNITKEGRGLTDTFKTKLLNITPPKDLKQLQS
                     ILGLLNFARNFIPNFAELVQPLYNLIASAKGKYIEWSEENTKQLNMVIEALNTASNLE
                     ERLPEQRLVIKVNTSPSAGYVRYYNETGKKPIMYLNYVFSKAELKFSMLEKLLTTMHK
                     ALIKAMDLAMGQEILVYSPIVSMTKIQKTPLPERKALPIRWITWMTYLEDPRIQFHYD
                     KTLPELKHIPDVYTSSQSPVKHPSQYEGVFYTDGSAIKSPDPTKSNNAGMGIVHATYK
                     PEYQVLNQWSIPLGNHTAQMAEIAAVEFACKKALKIPGPVLVITDSFYVAESANKELP
                     YWKSNGFVNNKKKPLKHISKWKSIAECLSMKPDITIQHEKGISLQIPVFILKGNALAD
                     KLATQGSYVVNCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKI
                     IPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNAS
                     NKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPST
                     SATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVE
                     RKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFA
                     NQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRW
                     HKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE"
     misc_difference 3150
                     /gene="gag"
                     /note="conflict; sequence derived from individual clones
                     that are in conflict with infectious clone pHSRV13"
                     /citation=[3]
                     /replace=""
     misc_difference 3153..3154
                     /gene="gag"
                     /note="conflict"
                     /citation=[3]
                     /replace=""
     misc_feature    <5453..6548
                     /note="encodes integrase; produced by proteolytic cleavage
                     from the putative 125 kDa pro-pol protein"
     misc_feature    5453..5456
                     /note="encodes putative cleavage site of integrase
                     protein"
     CDS             6496..9465
                     /citation=[1]
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="AAB48113.1"
                     /translation="MAPPMTLQQWIIWKKMNKAHEALQNTTTVTEQQKEQIILDIQNE
                     EVQPTRRDKFRYLLYTCCATSSRVLAWMFLVCILLIIVLVSCFVTISRIQWNKDIQVL
                     GPVIDWNVTQRAVYQPLQTRRIARSLRMQHPVPKYVEVNMTSIPQGVYYEPHPEPIVV
                     KERVLGLSQILMINSENIANNANLTQEVKKLLTEMVNEEMQSLSDVMIDFEIPLGDPR
                     DQEQYIHRKCYQEFANCYLVKYKEPKPWPKEGLIADQCPLPGYHAGLTYNRQSIWDYY
                     IKVESIRPANWTTKSKYGQARLGSFYIPSSLRQINVSHVLFCSDQLYSKWYNIENTIE
                     QNERFLLNKLNNLTSGTSVLKKRALPKDWSSQGKNALFREINVLDICSKPESVILLNT
                     SYYSFSLWEGDCNFTKDMISQLVPECDGFYNNSKWMHMHPYACRFWRSKKNEKEETKC
                     RDGETKRCLYYPLWDSPESTYDFGYLAYQKNFPSPICIEQQKIRDQDYEVYSLYQERK
                     IASKAYGIDTVLFSLKNFLNYTGTPVNEMPNARAFVGLIDPKFPPSYPNVTREHYTSC
                     NNRKRRSVDNNYAKLRSMGYALTGAVQTLSQISDINDENLQQGIYLLRDHVITLMEAT
                     LHDISVMEGMFAVQHLHTHLNHLKTMLLERRIDWTYMSSTWLQQQLQKSDDEMKVIKR
                     IARSLVYYVKQTHSSPTATAWEIGLYYELVIPKHIYLNNWNVVNIGHLVKSAGQLTHV
                     TIAHPYEIINKECVETIYLHLEDCTRQDYVICDVVKIVQPCGNSSDTSDCPVWAEAVK
                     EPFVQVNPLKNGSYLVLASSTDCQIPPYVPSIVTVNETTSCFGLDFKRPLVAEERLSF
                     EPRLPNLQLRLPHLVGIIAKIKGIKIEVTSSGESIKEQIERAKAELLRLDIHEGDTPA
                     WIQQLAAATKDVWPAAASALQGIGNFLSGTAQGIFGTAFSLLGYLKPILIGVGVILLV
                     ILIFKIVSWIPTKKKNQ"
     regulatory      9019..9195
                     /regulatory_class="promoter"
                     /note="internal promoter for bel1, bel2 and bet genes"
                     /citation=[6]
     gene            9165..9169
                     /gene="bel"
     regulatory      9165..9169
                     /regulatory_class="TATA_box"
                     /gene="bel"
                     /citation=[6]
     misc_feature    9196..9309
                     /note="leader RNA formed from the internal promoter for
                     bel1, bel2 and Bet genes"
     misc_feature    9196
                     /note="cap site"
     gene            9435..11184
                     /gene="bet"
     CDS             join(9435..9699,10001..11184)
                     /gene="bet"
                     /citation=[5]
                     /codon_start=1
                     /product="Bet"
                     /protein_id="AAB48114.1"
                     /translation="MDSYEKEESVASTSGIQDLQTLSELVGPENAGEGELTIAEEPEE
                     NPRRPRRYTKREVKCVSYHAYKEIEDKHPQHIKLQDWIPTPEEMIAQKVQNQDLGTIL
                     SFDVTCLKSITSLGRNDPGDDPSIMSHVLPVVTPWPMSQDHYAPTLFGILDRYYQGYL
                     KSPATYQTWKFTCQVDPSGKRFMETQFWVPPLGQVNIQFYKNYQILTCCQAVDPFANI
                     FHGTDEEMFDIDSGPDVWCSPSLCFKVIYEGAMGQKQEQKTWLCRLGHGHRMGACDYR
                     KVDLYAMRQGKENPYGDRGDAALQYAYQVKRGCKAGCLASPVLNYKALQFHRTIMADF
                     TNPRIGEGHLAHGYQAAMEAYGPQRGSNEERVWWNVTRNQGKQGGEYYREGGEEPHYP
                     NTPAPHRRTWDERHKVLKLSSFATPSDIQRWTTKALPYGWKVVTESGNDYTSRRKIRT
                     LTEMTQDEIRKRWESGYCDPFIDSGSDSDGPF"
     gene            9435..10337
                     /gene="bel1"
     CDS             9435..10337
                     /gene="bel1"
                     /note="transcriptional transactivator"
                     /codon_start=1
                     /product="Bel1"
                     /protein_id="AAB48115.1"
                     /translation="MDSYEKEESVASTSGIQDLQTLSELVGPENAGEGELTIAEEPEE
                     NPRRPRRYTKREVKCVSYHAYKEIEDKHPQHIKLQDWIPTPEEMSKSLCKRLILCGLY
                     SAEKASEILRMPFTVSWEQSDTDPDCFIVSYTCIFCDAVIHDPMPIRWDPEVGIWVKY
                     KPLRGIVGSAVFIMHKHQRNCSLVKPSTSCSEGPKPRPRHDPVLRCDMFEKHHKPRQK
                     RPRRRSIDNESCASSSDTMANEPGSLCTNPLWNPGPLLSGLLEESSNLPNLEVHMSGG
                     PFWEEVYGDSILGPPSGSGEHSVL"
     gene            10114..11184
                     /gene="bel2"
     CDS             10114..11184
                     /gene="bel2"
                     /citation=[5]
                     /codon_start=1
                     /product="Bel2"
                     /protein_id="AAB48116.1"
                     /translation="MSHVLPVVTPWPMSQDHYAPTLFGILDRYYQGYLKSPATYQTWK
                     FTCQVDPSGKRFMETQFWVPPLGQVNIQFYKNYQILTCCQAVDPFANIFHGTDEEMFD
                     IDSGPDVWCSPSLCFKVIYEGAMGQKQEQKTWLCRLGHGHRMGACDYRKVDLYAMRQG
                     KENPYGDRGDAALQYAYQVKRGCKAGCLASPVLNYKALQFHRTIMADFTNPRIGEGHL
                     AHGYQAAMEAYGPQRGSNEERVWWNVTRNQGKQGGEYYREGGEEPHYPNTPAPHRRTW
                     DERHKVLKLSSFATPSDIQRWTTKALPYGWKVVTESGNDYTSRRKIRTLTEMTQDEIR
                     KRWESGYCDPFIDSGSDSDGPF"
     gene            10607..11089
                     /gene="bel3"
     CDS             10607..11089
                     /gene="bel3"
                     /citation=[7]
                     /codon_start=1
                     /product="Bel3"
                     /protein_id="AAB48117.1"
                     /translation="MEIGVMQLCNMLIRLKGAVKQGAWHHLYLTTKLCSFIEPLWQTS
                     PILGLEKDILLMVTKQLWKLMDLREEVTRRGCGGMSLETRENKEESITGKEVKNLITQ
                     ILLLLIDVPGMRDTRFLNCPHSLLPLTSNAGLLKHCLMAGKWSPKAEMIILAAERSEH
                     "
     repeat_region   11111..>11954
                     /citation=[2]
                     /rpt_type=long_terminal_repeat
     regulatory      11175..11181
                     /regulatory_class="polyA_signal_sequence"
                     /gene="bel2"
     polyA_site      11180
                     /gene="bel2"
BASE COUNT         4027 a         2169 c         2375 g         3383 t
ORIGIN      
        1 tgtggtggaa tgccactaga aactagggaa aactaggagg agagtattac agggaaggaa
       61 gtgaagaacc tcgtgaccca aatactcctg ctcctcatag acgtacctgg gatgagagac
      121 acaaggttct taaattgtcc tcattcgcta ctccctctga catccaacgc tgggctacta
      181 aagcattgcc ttatggctgg aaagtggtca ccgaaagcgg aaatgattat actagccgca
      241 gaaagatcag aacattgaca gagatgactc aggatgaaat tagaaaaagg tgggaaagtg
      301 gatattgtga ccccttcatt gactcaggaa gtgactcaga tggacccttc taaaagccac
      361 agacagtaaa aatgtgttag cactttatac aatattatat ctgcttaagc tatagaagct
      421 ttcacatact cagtagctgt ttcacaatca acaaaacaat gatgatgtaa tcataaggaa
      481 gtagtttaaa ataggttaat aagtttatta gttatataga aaataatata ggataaagta
      541 taaggattaa ggtatgaggt gtgtggctca acacgtaggg tgacaagaaa atctactgta
      601 ataggacaca acacctctaa agttgcccgt gggaaggtga agtgagatcg aatctttcct
      661 taacgcagac agctttttat ccactaggga taatgtttta aggaatacta tagtaataga
      721 ttgatagttt taacaatgat ggaaatagta tataaggata gtttctagat tgtacgggag
      781 ctcttcacta ctcgctgcgt cgagagtgta cgagactctc caggtttggt aagaaatatt
      841 ttatattgtt ataatgttac tatgatccat taacactctg cttatagatt gtaagggtga
      901 ttgcaatgct ttctgcataa aactttggtt ttcttgttaa tcaataaacc gacttgattc
      961 gagaacctac tcatatatta ttgtctcttt tatactttat taagtaaaag gatttgtata
     1021 ttagccttgc taagggagac atctagtgat ataagtgtga actacactta tcttaaatga
     1081 tgtaactcct taggataatc aatatacaaa attccatgac aattggcgcc caacgtgggg
     1141 ctcgaatata agtcgggttt atttgtaaat tatccctagg gacctccgag catagcggga
     1201 ggcatataaa agccaataga caatggcttc aggaagtaat gttgaagaat atgaacttga
     1261 tgttgaagct ctggttgtaa ttttaagaga tagaaatata ccaagaaatc ctttacatgg
     1321 agaagttata ggtcttcgcc ttactgaagg atggtgggga caaattgaga gatttcagat
     1381 ggtacgtcta atattacaag atgatgataa tgaaccttta cagagaccta gatatgaggt
     1441 aatacaacga gctgtaaacc ctcatacaat gtttatgata tcaggaccat tagctgaact
     1501 tcaattagcc tttcaggatt tagatttacc tgaaggtcca ttgaggtttg gtccattggc
     1561 aaatggacat tatgttcaag gagatcctta tagtagttct tacagaccag taacaatggc
     1621 cgaaacagcc caaatgacta gagatgaact ggaagatgtt cttaatactc aaagtgaaat
     1681 agaaattcaa atgataaatt tattggagtt gtatgaagtt gaaactagag ctcttagaag
     1741 acaattagct gagagatcta gtacagggca aggaggaata tccccaggag ctcctcgttc
     1801 tcgaccacca gtaagcagct tctcagggtt accaagtttg ccctctatac ctgggattca
     1861 tcccagggca ccttcacctc caagggcaac ttctactccc ggaaatattc cttggagttt
     1921 aggagatgat agcccacctt catctagttt tcctggaccc tctcaacctc gtgtttcttt
     1981 ccatccggga aatccttttg ttgaagaaga aggtcataga cctagatccc agtctagaga
     2041 aaggagaaga gaaattcttc ctgctcctgt accgtcagca cctcctatga ttcagtatat
     2101 accagtacca cctccaccac cgattggcac ggttatacct attcagcata tcagatctgt
     2161 aactggagag cctcctagaa acccaagaga aataccaatt tggctaggac gaaatgctcc
     2221 tgctatagat ggagtgttcc ctgttacaac accggatcta agatgcagaa taattaatgc
     2281 tatactagga ggaaatattg ggctatcatt aacccctgga gactgtttaa catgggactc
     2341 agcagtagcc accttattta ttagaaccca tggaactttt ccaatgcatc agcttggaaa
     2401 tgtaataaaa ggcatagttg atcaagaagg agtggcaaca gcatatactt tgggaatgat
     2461 gctttctgga caaaattatc aattagtttc tggaataatt agaggatatt tgcctggaca
     2521 agctgtagta actgcattac aacagcgttt agaccaagaa atagataatc aaacaagagc
     2581 agagactttt attcaacatc taaatgctgt atatgaaatt ttaggcctta atgccagagg
     2641 acaaagtata cgtgcttcag tgactcctca accccgacca tccagaggta gaggtcgagg
     2701 tcaaaatact tctagaccct ctcaaggacc agctaatagc gggcggggac gacagcgccc
     2761 tgcttctggt caaagcaaca gaggatctag tactcagaat caaaatcaag ataatttaaa
     2821 tcaaggagga tataatcttc gaccccgtac ttaccaacct caaaggtacg gaggaggacg
     2881 tggacgaaga tggaacgata atactaacaa tcaagagtcc agaccatcag atcaaggttc
     2941 tcaaactcct aggccaaatc aagcaggctc tggggtgcgt ggcaatcagt cacaaactcc
     3001 cagaccagct gctggtcgcg gaggaagagg taaccacaac cgaaaccaac gatcatccgg
     3061 tgctggtgac tcacgcgctg tcaataccgt gacacagagt gccacgtcct ccacagatga
     3121 atcctcttca gctgttacag ccgcttccgg cggagatcaa agggactaaa ttgttagccc
     3181 actgggattc aggggcaaca ataacttgta ttcctgaaag ttttttagaa gatgaacaac
     3241 ctattaaaaa gactttaata aaaacaattc atggagaaaa acaacaaaat gtttattatg
     3301 taacctttaa agttaaagga agaaaagtgg aagcagaagt gatagcttct ccttatgagt
     3361 atattttgct gtcgccaaca gatgttcctt ggttaacaca gcaaccactt cagttaacaa
     3421 ttttagttcc tcttcaagaa tatcaagaga aaatcttaag taagactgct cttccagaag
     3481 atcaaaaaca acaattaaaa accttgtttg tcaagtatga caatctatgg caacattggg
     3541 aaaatcaagt cgggcataga aaaattaggc cacataatat agcaactggt gattatcctc
     3601 ctcgccctca aaaacaatat cctattaatc ctaaggcaaa gcctagtata caaattgtaa
     3661 tagatgactt attgaaacaa ggggtgttaa cgcctcaaaa tagtacaatg aatacaccag
     3721 tgtatcctgt tcctaaacca gatggaaggt ggagaatggt attagattat agagaagtaa
     3781 ataaaactat tccattaaca gctgcccaaa accaacactc tgctggtatt ttagctacta
     3841 ttgttagaca aaaatataaa actaccttag atttagctaa tggattttgg gctcatccta
     3901 ttacaccaga atcttattgg ttaacagcat ttacctggca aggtaaacag tattgttgga
     3961 cacgtcttcc tcaaggattt ttaaatagtc cagcattgtt tacagctgat gtagtagatt
     4021 tactaaaaga aatccctaat gtacaagtgt atgttgatga tatatattta agccatgatg
     4081 atcctaaaga gcatgttcaa caattagaaa aagtgtttca aattttacta caggcaggat
     4141 atgtagtatc tttgaaaaaa tcagaaattg gtcaaaaaac tgtagaattt ttaggattta
     4201 atattactaa agaaggtcgt ggcctaacag acacttttaa aacaaaactg ttaaatatta
     4261 ctcctccaaa agacttaaag caattacaaa gcatattagg attgttaaat tttgctagaa
     4321 attttatacc taattttgct gaactggtac aaccattata caatttaata gcctcagcaa
     4381 aaggcaaata tattgagtgg tctgaagaaa atactaaaca attaaatatg gtaatagaag
     4441 cattaaacac tgcctctaat ttagaagaaa ggttaccaga acagagactg gtaattaaag
     4501 tcaatacttc tccatcagca ggatatgtaa gatattataa tgagactggt aaaaagccta
     4561 ttatgtacct aaattatgtg ttttccaaag cagaattaaa attttctatg ttagaaaaac
     4621 tattaactac aatgcacaaa gccttaatta aggctatgga tttggccatg ggacaagaaa
     4681 tattagttta tagtcccatt gtatctatga ctaaaataca aaaaactcca ctaccagaaa
     4741 gaaaagcttt acccattaga tggataacat ggatgactta tttagaagat ccaagaatcc
     4801 aatttcatta tgataaaacc ttaccagaac ttaagcatat tccagatgta tatacatcta
     4861 gtcagtctcc tgttaaacat ccttctcaat atgaaggagt gttttatact gatggctcgg
     4921 ccatcaaaag tcctgatcct acaaaaagca ataatgctgg catgggaata gtacatgcca
     4981 catacaaacc tgaatatcaa gttttgaatc aatggtcaat accactaggt aatcatactg
     5041 ctcagatggc tgaaatagct gcagttgaat ttgcctgtaa aaaagcttta aaaatacctg
     5101 gtcctgtatt agttataact gatagtttct atgtagcaga aagtgctaat aaagaattac
     5161 catactggaa atctaatggg tttgttaata ataagaaaaa gcctcttaaa catatctcca
     5221 aatggaaatc tattgctgag tgtttatcta tgaaaccaga cattactatt caacatgaaa
     5281 aaggcatcag cctacaaata ccagtattca tactgaaagg caatgcccta gcagataagc
     5341 ttgccaccca aggaagttat gtggttaatt gtaataccaa aaaaccaaac ctggatgcag
     5401 agttggatca attattacag ggtcattata taaaaggata tcccaaacaa tatacatatt
     5461 ttttagaaga tggcaaagta aaagtttcca gacctgaagg ggttaaaatt attccccctc
     5521 agtcagacag acaaaaaatt gtgcttcaag cccacaattt ggctcacacc ggacgtgaag
     5581 ccactctttt aaaaattgcc aacctttatt ggtggccaaa tatgagaaag gatgtggtta
     5641 aacaactagg acgctgtcaa cagtgtttaa tcacaaatgc ttccaacaaa gcctctggtc
     5701 ctattctaag accagatagg cctcaaaaac cttttgataa attctttatt gactatattg
     5761 gacctttgcc accttcacag ggatacctat atgtattagt agttgttgat ggaatgacag
     5821 gattcacttg gttatacccc actaaggctc cttctactag cgcaactgtt aaatctctca
     5881 atgtactcac tagtattgca attccaaagg tgattcactc tgatcaaggt gcagcattca
     5941 cttcttcaac ctttgctgaa tgggcaaagg aaagaggtat acatttggaa ttcagtactc
     6001 cttatcaccc ccaaagtggt agtaaggtgg aaaggaaaaa tagtgatata aaacgacttt
     6061 taactaaact gctagtagga agacccacaa agtggtatga cctattgcct gttgtacaac
     6121 ttgctttaaa caacacctat agccctgtat taaaatatac tccacatcaa ctcttatttg
     6181 gtatagattc aaatactcca tttgcaaatc aagatacact tgacttgacc agagaagaag
     6241 aactttctct tttacaggaa attcgtactt ctttatacca tccatccacc cctccagcct
     6301 cctctcgttc ctggtctcct gttgttggcc aattggtcca ggagagggtg gctaggcctg
     6361 cttctttgag acctcgttgg cataaaccgt ctactgtact taaggtgttg aatccaagga
     6421 ctgttgttat tttggaccat cttggcaaca acagaactgt aagtatagat aatttaaaac
     6481 ctacttctca tcagaatggc accaccaatg acactgcaac aatggatcat ttggaaaaaa
     6541 atgaataaag cgcatgaggc acttcaaaat acaacaactg tgactgaaca gcagaaggaa
     6601 caaattatac tggacattca aaatgaagaa gtacaaccaa ctaggagaga taaatttaga
     6661 tatctgcttt atacttgttg tgctactagc tcaagagtat tggcctggat gtttttagtt
     6721 tgtatattgt taatcattgt tttggtttca tgctttgtga ctatatccag aatacaatgg
     6781 aataaggata ttcaggtatt aggacctgta atagactgga atgttactca aagagctgtt
     6841 tatcaaccct tacagactag aaggattgca cgttccctta gaatgcagca tcctgttcca
     6901 aaatatgtgg aggtaaatat gactagtatt ccacaaggtg tatactatga accccatccg
     6961 gaacccatag tggtgaagga gagggtccta ggtctttctc aaattctgat gattaattca
     7021 gaaaacattg ctaataatgc taatttgaca caagaagtaa agaagttgtt aactgaaatg
     7081 gttaatgaag aaatgcaaag tttgtcagat gtaatgattg actttgaaat tcctttagga
     7141 gaccctcgtg atcaagaaca atatatacat agaaaatgct atcaagaatt tgcaaattgt
     7201 tatttagtaa aatataaaga acccaaaccg tggcctaagg agggccttat agctgatcaa
     7261 tgcccattac caggttacca tgctggatta acctataata gacagtctat ttgggattac
     7321 tatattaaag tggagagtat tagacctgca aattggacaa caaagagtaa atatggacaa
     7381 gctagactag gaagttttta tattcctagc agcctgagac aaatcaatgt tagtcatgta
     7441 ctattctgta gtgatcaatt atattctaaa tggtataata tagaaaatac catagaacaa
     7501 aacgagcggt ttctgcttaa taaactaaat aaccttacat ctggaacctc agtattgaag
     7561 aaaagagctc ttccgaagga ttggagttct caaggtaaaa atgctctgtt tagagaaatc
     7621 aatgtgttag atatctgcag taaacctgaa tctgtaatac tattgaatac ttcatactat
     7681 tccttctctt tatgggaagg agattgtaat tttactaaag atatgatttc tcagttggtt
     7741 ccagaatgtg atggatttta taacaattct aagtggatgc atatgcatcc atatgcttgt
     7801 agattctgga gaagtaagaa gaatgaaaaa gaagaaacta aatgtagaga tggggaaact
     7861 aagagatgtc tgtattatcc tttatgggac agtcccgaat ctacatatga ttttggttat
     7921 ttagcatacc aaaagaattt tccttcccct atctgtatag aacaacagaa aattagagat
     7981 caagattatg aagtctattc tttgtatcaa gaacgcaaaa tagcttctaa agcatatgga
     8041 attgatacag ttttattctc tctaaagaat tttcttaatt atacaggaac tcctgtaaat
     8101 gaaatgccta atgcaagagc ttttgtaggc ctaatagatc ccaagtttcc tccttcctat
     8161 cccaatgtta ctagggaaca ttatacttcc tgtaataata ggaaaagaag aagtgttgat
     8221 aataactatg ctaagttaag gtctatgggg tatgcactta caggagcagt gcaaacctta
     8281 tctcaaatat cagatattaa tgatgaaaac ttacagcaag gaatatattt attaagggat
     8341 catgtaataa ccttaatgga agctacattg catgatatat ctgttatgga aggaatgttt
     8401 gctgtacaac atttgcatac acatttgaat catttgaaga caatgcttct agaaagaaga
     8461 atagactgga cctatatgtc tagtacttgg ctacaacaac aattacagaa atctgatgat
     8521 gagatgaaag taataaagag aattgctaga agtttggtat attatgttaa acaaacccat
     8581 agttctccca cagctacagc ctgggagatt ggattatatt atgaattggt tatacctaaa
     8641 catatttact tgaataattg gaatgttgtc aatataggtc acttagttaa atcagctgga
     8701 caattgactc atgtaactat agctcatcct tatgaaataa tcaataagga atgtgtagag
     8761 actatatatc tgcatcttga ggactgcaca agacaagatt atgtcatatg tgatgtggta
     8821 aagatagtgc agccttgtgg caatagctca gacacgagtg attgtcctgt ctgggctgaa
     8881 gctgtaaaag aaccatttgt gcaagtcaat cctctgaaaa acggaagtta tctggttttg
     8941 gcaagttcca cagactgtca gatcccacca tatgttccta gcatcgtgac tgttaatgaa
     9001 acaacgtcat gctttggact ggactttaaa aggccactgg ttgcggaaga aagattgagc
     9061 tttgagccac gactgccaaa tctacaacta agattaccac atttggttgg aattattgca
     9121 aaaatcaaag ggataaaaat agaagtcaca tcctctggag aaagtataaa agagcagatt
     9181 gaaagagcaa aagctgagct ccttcgactg gacattcacg agggagatac tcctgcctgg
     9241 atacaacagc tagctgcagc aacaaaggac gtctggccag cagcagcttc tgctctacaa
     9301 ggaattggta actttttatc tgggactgcc caaggaatat ttggaactgc ctttagtctc
     9361 ttgggatact taaagcctat cctaatagga gtaggggtca ttctcttggt tattcttata
     9421 tttaagattg tatcatggat tcctacgaaa aagaagaatc agtagcctcc acctctggaa
     9481 ttcaggacct gcagactctg agtgagcttg ttggccctga aaatgccgga gagggagagc
     9541 tgactattgc tgaggaacct gaagaaaatc ctcgacgccc cagacgatat accaaaagag
     9601 aagtcaaatg tgtgtcttat catgcatata aagaaattga ggacaaacat cctcaacata
     9661 ttaaactgca ggattggatc cccacaccag aggaaatgag taagtcactc tgtaaaagac
     9721 ttattttatg tggattgtat agtgcagaaa aggcctcaga gattttaagg atgcctttta
     9781 cagtttcttg ggaacaatca gatactgacc ctgactgttt tattgtaagc tatacatgta
     9841 tattttgtga tgctgtaata catgatccca tgcccataag atgggatcct gaagttggaa
     9901 tttgggtaaa atataaaccc ctcagaggaa ttgttggatc tgctgtgttt attatgcata
     9961 aacatcaaag aaactgttct cttgttaaac cttctaccag ttgctcagaa ggtccaaaac
    10021 caagacctag gcacgatcct gtccttcgat gtgacatgtt tgaaaagcat cacaagcctc
    10081 ggcagaaacg acccaggaga cgatccatcg ataatgagtc atgtgcttcc agtagtgaca
    10141 ccatggccaa tgagccagga tcactatgca ccaaccctct ttggaatcct ggaccgctac
    10201 tatcagggct acttgaagag tccagcaacc taccaaactt ggaagttcac atgtcaggtg
    10261 gacccttctg ggaagaggtt tatggagact caattttggg tcccccctct gggtcaggtg
    10321 aacattcagt tttataagaa ttatcagatt ctaacttgct gtcaggctgt agacccattt
    10381 gctaatattt ttcatggtac tgatgaagaa atgtttgaca ttgattcagg tcctgatgtt
    10441 tggtgttctc cctctttgtg tttcaaggta atttatgaag gggcaatggg ccaaaagcaa
    10501 gaacaaaaaa cctggctgtg cagactagga catggtcatc gtatgggagc atgcgattac
    10561 cgtaaggtag atctgtatgc aatgagacaa ggaaaagaaa acccttatgg agataggggt
    10621 gatgcagctt tgcaatatgc ttatcaggtt aaaaggggct gtaaagcagg gtgcttggca
    10681 tcacctgtac ttaactacaa agctttgcag tttcatagaa ccattatggc agacttcacc
    10741 aatcctagga ttggagaagg acatcttgct catggttacc aagcagctat ggaagcttat
    10801 ggacctcaga gaggaagtaa cgaggagagg gtgtggtgga atgtcactag aaaccaggga
    10861 aaacaaggag gagagtatta cagggaagga ggtgaagaac ctcattaccc aaatactcct
    10921 gctcctcata gacgtacctg ggatgagaga cacaaggttc ttaaattgtc ctcattcgct
    10981 actccctctg acatccaacg ctggactact aaagcattgc cttatggctg gaaagtggtc
    11041 accgaaagcg gaaatgatta tactagccgc agaaagatca gaacattgac agagatgact
    11101 caggatgaaa ttagaaaaag gtgggaaagt ggatattgtg accccttcat tgactcagga
    11161 agtgactcag atggaccctt ctaaaagcca cagacagtaa aaatgtgtta gcactttata
    11221 caatattata tctgcttaag ctatagaagc tttcacatac tcagtagctg tttcacaatc
    11281 aacaaaacaa tgatgatgta atcataagga agtagtttaa aataggttaa gtaagtttat
    11341 tagttatata gaaaataata taggataagg tataaggatt aaggtatgag gtgtgtggct
    11401 caacacgtag ggtgacaaga aaatctactg taataggaca caacacctct aaagttgccc
    11461 gtgggaaggt gaagtgagat cgaatctttc cttaacgcag acagcttttt atccactagg
    11521 gataatgttt taaggaatac tatagtaata gattgatagt tttaacaatg atagaaatag
    11581 tatataagga tagtttctag attgtacggg aggctcttca ctactcgctg cgtcgagagt
    11641 gtacgagact ctccaggttt ggtaagaaat attttatatt gttataatgt tactatgatc
    11701 cattaacact ctgcttatag attgtaaggg tgattgcaat gctttctgca taaaactttg
    11761 gttttcttgt taatcaataa accgacttga ttcgagaacc aactcctata ttattgtctc
    11821 ttttatactt tattaagtaa aaggatttgt atattagcct tgctaaggga gacatctagt
    11881 gatataagtg tgaactacac ttatcttaaa tgatgtaact ccttaggata atcaatatac
    11941 aaaattccat gaca
//