LOCUS       HSU20938                4409 bp    mRNA    linear   HUM 04-APR-1997
DEFINITION  Human lymphocyte dihydropyrimidine dehydrogenase mRNA, complete
            cds.
ACCESSION   U20938
VERSION     U20938.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4409)
  AUTHORS   Diasio,R.B., Beavers,T.L. and Carpenter,J.T.
  TITLE     Familial deficiency of dihydropyrimidine dehydrogenase. Biochemical
            basis for familial pyrimidinemia and severe 5-fluorouracil-induced
            toxicity
  JOURNAL   J. Clin. Invest. 81 (1), 47-51 (1988)
   PUBMED   3335642
REFERENCE   2  (bases 1 to 4409)
  AUTHORS   Lu,Z.H., Zhang,R. and Diasio,R.B.
  TITLE     Purification and characterization of dihydropyrimidine
            dehydrogenase from human liver
  JOURNAL   J. Biol. Chem. 267 (24), 17102-17109 (1992)
   PUBMED   1512248
REFERENCE   3  (bases 1 to 4409)
  AUTHORS   Johnson,M.R., Albin,N., Shahinian,H. and Diasio,R.B.
  TITLE     Identification of a frameshift in the DNA coding for
            dihydropyrimidine dehydrogenase (DPD) in a DPD deficient patient
            exhibiting 5-fluorouracil toxicity
  JOURNAL   Unpublished
REFERENCE   4  (bases 1 to 4409)
  AUTHORS   Johnson,M.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-FEB-1995) Pharmacology, University of Alabama at
            Birmingham, 1670 University Blvd., Birmingham, AL 35294-0019, USA
COMMENT     On Apr 4, 1997 this sequence version replaced gi:693911.
FEATURES             Location/Qualifiers
     source          1..4409
                     /db_xref="H-InvDB:HIT000218575"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="lymphocyte"
     CDS             102..3179
                     /EC_number="1.2.1.2"
                     /note="DPD; dihydrouracil dehydrogenase"
                     /codon_start=1
                     /product="dihydropyrimidine dehydrogenase"
                     /protein_id="AAB51366.1"
                     /db_xref="GI:693912"
                     /translation="MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRN
                     PDKNCFNCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSFIT
                     SIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFAT
                     EVFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFE
                     KQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGY
                     KAAFIGIGLPEPNKDAIFQGLTQDQGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGV
                     VIVLGAGDTAFDCATSALRCGARRVFIVFRKGFVNIRAVPEEMELAKEEKCEFLPFLS
                     PRKVIVKGGRIVAMQFVRTEQDETGKWNEDEDQMVHLKADVVISAFGSVLSDPKVKEA
                     LSPIKFNRWGLPEVDPETMQTSEAWVFAGGDVVGLANTTVESVNDGKQASWYIHKYVQ
                     SQYGASVSAKPELPLFYTPIDLVDISVEMAGLKFINPFGLASATPATSTSMIRRAFEA
                     GWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMYGPGQSSFLNIELISEKTAAYWCQS
                     VTELKADFPDNIVIASIMCSYNKNDWTELAKKSEDSGADALELNLSCPHGMGERGMGL
                     ACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSIARAAKEGGANGVTATNTVSG
                     LMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTSIARALPGFPILATGGIDS
                     AESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYLKSIEELQDWDGQSPAT
                     VSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQNVAFSPLKRNCFIP
                     KRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCYMTCNDSGYQAIQ
                     FDPETHLPTITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLSVNPVC"
BASE COUNT         1317 a          845 c          949 g         1298 t
ORIGIN      
        1 tttcgactcg cgctccggct gctgtcactt ggctctctgg ctggagcttg aggacgcaag
       61 gagggtttgt cactggcaga ctcgagactg taggcactgc catggcccct gtgctcagta
      121 aggactcggc ggacatcgag agtatcctgg ctttaaatcc tcgaacacaa actcatgcaa
      181 ctctgtgttc cacttcggcc aagaaattag acaagaaaca ttggaaaaga aatcctgata
      241 agaactgctt taattgtgag aagctggaga ataattttga tgacatcaag cacacgactc
      301 ttggtgagcg aggagctctc cgagaagcaa tgagatgcct gaaatgtgca gatgccccgt
      361 gtcagaagag ctgtccaact aatcttgata ttaaatcatt catcacaagt attgcaaaca
      421 agaactatta tggagctgct aagatgatat tttctgacaa cccacttggt ctgacttgtg
      481 gaatggtatg tccaacctct gatctttgtg taggtggatg caatttatat gccactgaag
      541 agggacccat taatattggt ggattgcagc aatttgctac tgaggtattc aaagcaatga
      601 gtatcccaca gatcagaaat ccttcgctgc ctcccccaga aaaaatgtct gaagcctatt
      661 ctgcaaagat tgctcttttt ggtgctgggc ctgcaagtat aagttgtgct tcctttttgg
      721 ctcgattggg gtactctgac atcactatat ttgaaaaaca agaatatgtt ggtggtttaa
      781 gtacttctga aattcctcag ttccggctgc cgtatgatgt agtgaatttt gagattgagc
      841 taatgaagga ccttggtgta aagataattt gcggtaaaag cctttcagtg aatgaaatga
      901 ctcttagcac tttgaaagaa aaaggctaca aagctgcttt cattggaata ggtttgccag
      961 aacccaataa agatgccatc ttccaaggcc tgacgcagga ccaggggttt tatacatcca
     1021 aagacttttt gccacttgta gccaaaggca gtaaagcagg aatgtgcgcc tgtcactctc
     1081 cattgccatc gatacgggga gtcgtgattg tacttggagc tggagacact gcctttgact
     1141 gtgcaacatc tgctctacgt tgtggagctc gccgtgtgtt catcgtcttc agaaaaggct
     1201 ttgttaatat aagagctgtc cctgaggaga tggaacttgc taaggaagaa aagtgtgaat
     1261 ttctgccatt cctgtcccca cggaaggtta tagtaaaagg tgggagaatt gttgctatgc
     1321 agtttgttcg gacagagcaa gatgaaactg gaaaatggaa tgaagatgaa gatcagatgg
     1381 tccatctgaa agccgatgtg gtcatcagtg cctttggttc agttctgagt gatcctaaag
     1441 taaaagaagc cttgagccct ataaaattta acagatgggg tctcccagaa gtagatccag
     1501 aaactatgca aactagtgaa gcatgggtat ttgcaggtgg tgatgtcgtt ggtttggcta
     1561 acactacagt ggaatcggtg aatgatggaa agcaagcttc ttggtacatt cacaaatacg
     1621 tacagtcaca atatggagct tccgtttctg ccaagcctga actacccctc ttttacactc
     1681 ctattgatct ggtggacatt agtgtagaaa tggccggatt gaagtttata aatccttttg
     1741 gtcttgctag cgcaactcca gccaccagca catcaatgat tcgaagagct tttgaagctg
     1801 gatggggttt tgccctcacc aaaactttct ctcttgataa ggacattgtg acaaatgttt
     1861 cccccagaat catccgggga accacctctg gccccatgta tggccctgga caaagctcct
     1921 ttctgaatat tgagctcatc agtgagaaaa cggctgcata ttggtgtcaa agtgtcactg
     1981 aactaaaggc tgactttcca gacaacattg tgattgctag cattatgtgc agttacaata
     2041 aaaatgactg gacggaactt gccaagaagt ctgaggattc tggagcagat gccctggagt
     2101 taaatttatc atgtccacat ggcatgggag aaagaggaat gggcctggcc tgtgggcagg
     2161 atccagagct ggtgcggaac atctgccgct gggttaggca agctgttcag attccttttt
     2221 ttgccaagct gaccccaaat gtcactgata ttgtgagcat cgcaagagct gcaaaggaag
     2281 gtggtgccaa tggcgttaca gccaccaaca ctgtctcagg tctgatggga ttaaaatctg
     2341 atggcacacc ttggccagca gtggggattg caaagcgaac tacatatgga ggagtgtctg
     2401 ggacagcaat cagacctatt gctttgagag ctgtgacctc cattgctcgt gctctgcctg
     2461 gatttcccat tttggctact ggtggaattg actctgctga aagtggtctt cagtttctcc
     2521 atagtggtgc ttccgtcctc caggtatgca gtgccattca gaatcaggat ttcactgtga
     2581 tcgaagacta ctgcactggc ctcaaagccc tgctttatct gaaaagcatt gaagaactac
     2641 aagactggga tggacagagt ccagctactg tgagtcacca gaaagggaaa ccagttccac
     2701 gtatagctga actcatggac aagaaactgc caagttttgg accttatctg gaacagcgca
     2761 agaaaatcat agcagaaaac aagattagac tgaaagaaca aaatgtagct ttttcaccac
     2821 ttaagagaaa ctgttttatc cccaaaaggc ctattcctac catcaaggat gtaataggaa
     2881 aagcactgca gtaccttgga acatttggtg aattgagcaa cgtagagcaa gttgtggcta
     2941 tgattgatga agaaatgtgt atcaactgtg gtaaatgcta catgacctgt aatgattctg
     3001 gctaccaggc tatacagttt gatccagaaa cccacctgcc caccataacc gacacttgta
     3061 caggctgtac tctgtgtctc agtgtttgcc ctattgtcga ctgcatcaaa atggtttcca
     3121 ggacaacacc ttatgaacca aagagaggcg tacccttatc tgtgaatccg gtgtgttaag
     3181 gtgatttgtg aaacagttgc tgtgaacttt catgtcacct acatatgctg atcttttaaa
     3241 atcatgatcc ttgtgttcag ctctttccaa attaaaacaa atatacattt tctaaataaa
     3301 aatatgtaat ttcaaaatac atttgtaagt gtaaaaaatg tctcatgtca atgaccattc
     3361 aattagtggt cataaaatag aataattctt ttctgaggat agtagttaaa taactgtgtg
     3421 gcagttaatt ggatgttcac tgccagttgt cttatgtgaa aaattaactt ttttgtggca
     3481 attagtgtga cagtttccaa attgccctat gctgtgctcc atatttgatt tctaattgta
     3541 agtgaaatta agcattttga aacaaagtac tctttaacat acaagaaaat gtatccaagg
     3601 aaacatttta tcattaaaaa ttacctttaa ttttaatgct gtttctaaga aaatgtagtt
     3661 agctccataa agtacaaatg aagaaagtca aaaaattatt tgctatggca ggataagaaa
     3721 gcctaaaatt gagtttgtag aactttatta agtaaaatcc ccttcgctga aattgcttat
     3781 ttttggtgtt ggatagagga tagggagaat atttactaac taaataccat tcactactca
     3841 tgcgtgagat gggtgtacaa actcatcctc ttttaatggc atttctcttt aaactatgtt
     3901 cctaacaaaa tgagatgata ggatagatcc tggttaccac tcttttgctg tgcacatacg
     3961 ggctctgact ggttttaata gtcaccttca tgattatagc aactaatgtt tgaacaaagc
     4021 tcaaagtatg caatgcttca ttattcaaga atgaaaaata taatgttgat aatatatatt
     4081 aagtgtgcca aatcagtttg actactctct gttttagtgt ttatgtttaa aagaaatata
     4141 ttttttgtta ttattagata atatttttgt atttctctat tttcataatc agtaaatagt
     4201 gtcatataaa ctcatttatc tcctcttcat ggcatcttca atatgaatct ataagtagta
     4261 aatcagaaag taacaatcta tggcttattt ctatgacaaa ttcaagagct agaaaaataa
     4321 aatgtttcat tatgcacttt tagaaatgca tatttgccac aaaacctgta ttactgaata
     4381 atatcaaata aaatatcata aagcatttt
//