LOCUS       HSU20324                 630 bp    mRNA    linear   HUM 02-MAR-1996
DEFINITION  Human LIM domain protein (CLP) mRNA, complete cds.
ACCESSION   U20324
VERSION     U20324.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 630)
  AUTHORS   Fung,Y.W., Wang,R.X., Heng,H.H. and Liew,C.C.
  TITLE     Mapping of a human LIM protein (CLP) to human chromosome 11p15.1 by
            fluorescence in situ hybridization
  JOURNAL   Genomics 28 (3), 602-603 (1995)
   PUBMED   7490106
REFERENCE   2  (bases 1 to 630)
  AUTHORS   Liew,C.-C.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JAN-1995) Choong-Chin Liew, Clinical Biochemistry,
            University of Toronto, 100 College, Toronto, Ontario, M5G 1L5,
            Canada
FEATURES             Location/Qualifiers
     source          1..630
                     /db_xref="H-InvDB:HIT000218553"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11p15.1"
                     /clone="F2345"
                     /tissue_type="heart"
                     /dev_stage="fetus"
     gene            1..630
                     /gene="CLP"
     CDS             46..630
                     /gene="CLP"
                     /codon_start=1
                     /product="LIM domain protein"
                     /protein_id="AAA91104.1"
                     /db_xref="GI:790229"
                     /translation="MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKAL
                     DSTTVAAHESEIYCKVCYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSV
                     TTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVT
                     DKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE"
BASE COUNT          169 a          151 c          182 g          128 t
ORIGIN      
        1 ggagtccaca caggcagact tgaccttgac cagatagtct tcaagatgcc aaactggggc
       61 ggaggcgcaa aatgtggagc ctgtgaaaag accgtctacc atgcagaaga aatccagtgc
      121 aatggaagga gtttccacaa gacgtgtttc cactgcatgg cctgcaggaa ggctcttgac
      181 agcacgacag tcgcggctca tgagtcggag atctactgca aggtgtgcta tgggcgcaga
      241 tatggcccca aagggatcgg gtatggacaa ggcgctggct gtctcagcac agacacgggc
      301 gagcatctcg gcctgcagtt ccaacagtcc ccaaagccgg cacgctcagt taccaccagc
      361 aacccttcca aattcactgc gaagtttgga gagtccgaga agtgccctcg atgtggcaag
      421 tcagtctatg ctgctgagaa ggttatggga ggtggcaagc cttggcacaa gacctgtttc
      481 cgctgtgcca tctgtgggaa gagtctggag tccacaaatg tcactgacaa agatggggaa
      541 ctttattgca aagtttgcta tgccaaaaat tttggcccca cgggtattgg gtttggaggc
      601 cttacacaac aagtggaaaa gaaagaatga
//