LOCUS       HSU17248                1100 bp    mRNA    linear   HUM 13-NOV-1995
DEFINITION  Human succinate dehydrogenase iron-protein subunit (sdhB) gene,
            complete cds.
ACCESSION   U17248
VERSION     U17248.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1100)
  AUTHORS   Au,H.C., Ream-Robinson,D., Bellew,L.A., Broomfield,P.L.,
            Saghbini,M. and Scheffler,I.E.
  TITLE     Structural organization of the gene encoding the human iron-sulfur
            subunit of succinate dehydrogenase
  JOURNAL   Gene 159 (2), 249-253 (1995)
   PUBMED   7622059
REFERENCE   2  (bases 1 to 1100)
  AUTHORS   Scheffler,I.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-NOV-1994) Immo E. Scheffler, Biology, University of
            California at San Diego, 9500 Gilman Drive, La Jolla, CA 92093, USA
FEATURES             Location/Qualifiers
     source          1..1100
                     /db_xref="H-InvDB:HIT000218375"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /sex="male"
                     /tissue_type="whole liver"
                     /dev_stage="adult"
     gene            1..1100
                     /gene="sdhB"
     CDS             135..977
                     /gene="sdhB"
                     /note="Ip complex II"
                     /codon_start=1
                     /product="succinate dehydrogenase iron-protein subunit"
                     /protein_id="AAA81167.1"
                     /db_xref="GI:665925"
                     /translation="MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAI
                     YRWDPDKAGDKPHMQTYKVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCA
                     MNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKK
                     DESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRW
                     MIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEK
                     KASV"
     misc_feature    410..437
                     /gene="sdhB"
                     /note="encodes iron-sulfur cluster I"
     misc_feature    689..722
                     /gene="sdhB"
                     /note="encodes iron-sulfur cluster II"
     misc_feature    860..893
                     /gene="sdhB"
                     /note="encodes iron-sulfur cluster III"
     polyA_signal    1085..1090
                     /gene="sdhB"
     polyA_site      1100
                     /gene="sdhB"
                     /note="5 A nucleotides"
BASE COUNT          299 a          266 c          278 g          257 t
ORIGIN      
        1 ggcctcccac ttggttgctc gtacgcggct agtgggtcct cagtggatgt aggctgggcg
       61 ccgcgatgtt cgacgggaca ccggcggaga gcgacctcgg ggttaagggg tggggctgga
      121 cgtcaggagc caagatggcg gcggtggtcg cactctcctt gaggcgccgg ttgccggcca
      181 caacccttgg cggagcctgc ctgcaggcct cccgaggagc ccagacagct gcagccacag
      241 ctccccgtat caagaaattt gccatctatc gatgggaccc agacaaggct ggagacaaac
      301 ctcatatgca gacttataag gttgacctta ataaatgtgg ccccatggta ttggatgctt
      361 taatcaagat taagaatgaa gttgactcta ctttgacctt ccgaagatca tgcagagaag
      421 gcatctgtgg ctcttgtgca atgaacatca atggaggcaa cactctagct tgcacccgaa
      481 ggattgacac caacctcaat aaggtctcaa aaatctaccc tcttccacac atgtatgtga
      541 taaaggatct tgttcccgat ttgagcaact tctatgcaca gtacaaatcc attgagcctt
      601 atttgaagaa gaaggatgaa tctcaggaag gcaagcagca gtatctgcag tccatagaag
      661 agcgtgagaa actggacggg ctctacgagt gcattctctg tgcctgctgt agcaccagct
      721 gccccagcta ctggtggaac ggagacaaat atctggggcc tgcagttctt atgcaggcct
      781 atcgctggat gattgactcc agagatgact tcacagagga gcgcctggcc aagctgcagg
      841 acccattctc tctataccgc tgccacacca tcatgaactg cacaaggacc tgtcctaagg
      901 gtctgaatcc agggaaagct attgcagaga tcaagaaaat gatggcaacc tataaggaga
      961 agaaagcttc agtttaactg tttccatgct aaacatgatt tataaccagc tcagagctga
     1021 acataattta tatctaattt gagttccttt aaagatcttg gttttccatg aatacagcat
     1081 gtataataaa aattttaaga
//