LOCUS       HSU14680                5711 bp    mRNA    linear   HUM 10-JUN-2002
DEFINITION  Homo sapiens breast and ovarian cancer susceptibility (BRCA1) mRNA,
            complete cds.
ACCESSION   U14680
VERSION     U14680.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5711)
  AUTHORS   Miki,Y., Swensen,J., Shattuck-Eidens,D., Futreal,P.A., Harshman,K.,
            Tavtigian,S., Liu,Q., Cochran,C., Bennett,L.M., Ding,W., Bell,R.,
            Rosenthal,J., Hussey,C., Tran,T., McClure,M., Frye,C., Hattier,T.,
            Phelps,R., Haugen-Strano,A., Katcher,H., Yakumo,K., Gholami,Z.,
            Shaffer,D., Stone,S., Bayer,S., Wray,C., Bogden,R., Dayananth,P.,
            Ward,J., Tonin,P., Narod,S., Bristow,P.K., Norris,F.H.,
            Helvering,L., Morrison,P., Rosteck,P., Lai,M., Barrett,J.C.,
            Lewis,C., Neuhausen,S., Cannon-Albright,L., Goldgar,D., Wiseman,R.,
            Kamb,A. and Skolnick,M.H.
  TITLE     A strong candidate for the breast and ovarian cancer susceptibility
            gene BRCA1
  JOURNAL   Science 266 (5182), 66-71 (1994)
   PUBMED   7545954
REFERENCE   2  (bases 1 to 5711)
  AUTHORS   Skolnick,M.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-1994) Mark H. Skolnick, Myriad Genetics Inc. and
            the University of Utah, 421 Wakara Way, Suite 201, Salt Lake City,
            UT 84108, USA
FEATURES             Location/Qualifiers
     source          1..5711
                     /db_xref="H-InvDB:HIT000218274"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21; spans D17S855"
                     /note="For sequence of alternatively spliced exon 4, see
                     GenBank Accession Number U15595"
     gene            1..5711
                     /gene="BRCA1"
     5'UTR           1..119
                     /gene="BRCA1"
     exon            1..100
                     /gene="BRCA1"
                     /number=1
     exon            101..199
                     /gene="BRCA1"
                     /number=2
     CDS             120..5711
                     /gene="BRCA1"
                     /note="influences susceptibility to breast and ovarian
                     cancer"
                     /codon_start=1
                     /product="breast and ovarian cancer susceptibility"
                     /protein_id="AAA73985.1"
                     /db_xref="GI:555932"
                     /translation="MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFC
                     KFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYA
                     NSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLG
                     TVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISL
                     DSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGT
                     NTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTP
                     STEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDEL
                     LGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSK
                     SVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRP
                     TSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEK
                     NPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALE
                     LVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSN
                     KPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKV
                     SNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEP
                     NKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQY
                     LQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNE
                     SNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHG
                     LLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNN
                     IRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGV
                     LQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVC
                     SETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRR
                     GAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLS
                     LKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
                     SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSV
                     SEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDS
                     SALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVE
                     RSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY
                     LPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAES
                     AQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKF
                     ARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKER
                     KMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMV
                     QLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSV
                     ALYQCQELDTYLIPQIPHSHY"
     exon            200..253
                     /gene="BRCA1"
                     /number=3
     exon            254..331
                     /gene="BRCA1"
                     /number=5
     exon            332..420
                     /gene="BRCA1"
                     /number=6
     exon            421..560
                     /gene="BRCA1"
                     /number=7
     exon            561..665
                     /gene="BRCA1"
                     /number=8
     exon            666..712
                     /gene="BRCA1"
                     /number=9
     exon            713..788
                     /gene="BRCA1"
                     /number=10
     exon            789..4215
                     /gene="BRCA1"
                     /number=11
     exon            4216..4302
                     /gene="BRCA1"
                     /number=12
     exon            4303..4476
                     /gene="BRCA1"
                     /number=13
     exon            4477..4603
                     /gene="BRCA1"
                     /number=14
     exon            4604..4794
                     /gene="BRCA1"
                     /number=15
     exon            4795..5105
                     /gene="BRCA1"
                     /number=16
     exon            5106..5193
                     /gene="BRCA1"
                     /number=17
     exon            5194..5273
                     /gene="BRCA1"
                     /number=18
     exon            5274..5310
                     /gene="BRCA1"
                     /number=19
     exon            5311..5396
                     /gene="BRCA1"
                     /number=20
     exon            5397..5451
                     /gene="BRCA1"
                     /number=21
     exon            5452..5526
                     /gene="BRCA1"
                     /number=22
     exon            5527..5586
                     /gene="BRCA1"
                     /number=23
     exon            5587..5711
                     /gene="BRCA1"
                     /number=24
BASE COUNT         1956 a         1099 c         1274 g         1382 t
ORIGIN      
        1 agctcgctga gacttcctgg accccgcacc aggctgtggg gtttctcaga taactgggcc
       61 cctgcgctca ggaggccttc accctctgct ctgggtaaag ttcattggaa cagaaagaaa
      121 tggatttatc tgctcttcgc gttgaagaag tacaaaatgt cattaatgct atgcagaaaa
      181 tcttagagtg tcccatctgt ctggagttga tcaaggaacc tgtctccaca aagtgtgacc
      241 acatattttg caaattttgc atgctgaaac ttctcaacca gaagaaaggg ccttcacagt
      301 gtcctttatg taagaatgat ataaccaaaa ggagcctaca agaaagtacg agatttagtc
      361 aacttgttga agagctattg aaaatcattt gtgcttttca gcttgacaca ggtttggagt
      421 atgcaaacag ctataatttt gcaaaaaagg aaaataactc tcctgaacat ctaaaagatg
      481 aagtttctat catccaaagt atgggctaca gaaaccgtgc caaaagactt ctacagagtg
      541 aacccgaaaa tccttccttg caggaaacca gtctcagtgt ccaactctct aaccttggaa
      601 ctgtgagaac tctgaggaca aagcagcgga tacaacctca aaagacgtct gtctacattg
      661 aattgggatc tgattcttct gaagataccg ttaataaggc aacttattgc agtgtgggag
      721 atcaagaatt gttacaaatc acccctcaag gaaccaggga tgaaatcagt ttggattctg
      781 caaaaaaggc tgcttgtgaa ttttctgaga cggatgtaac aaatactgaa catcatcaac
      841 ccagtaataa tgatttgaac accactgaga agcgtgcagc tgagaggcat ccagaaaagt
      901 atcagggtag ttctgtttca aacttgcatg tggagccatg tggcacaaat actcatgcca
      961 gctcattaca gcatgagaac agcagtttat tactcactaa agacagaatg aatgtagaaa
     1021 aggctgaatt ctgtaataaa agcaaacagc ctggcttagc aaggagccaa cataacagat
     1081 gggctggaag taaggaaaca tgtaatgata ggcggactcc cagcacagaa aaaaaggtag
     1141 atctgaatgc tgatcccctg tgtgagagaa aagaatggaa taagcagaaa ctgccatgct
     1201 cagagaatcc tagagatact gaagatgttc cttggataac actaaatagc agcattcaga
     1261 aagttaatga gtggttttcc agaagtgatg aactgttagg ttctgatgac tcacatgatg
     1321 gggagtctga atcaaatgcc aaagtagctg atgtattgga cgttctaaat gaggtagatg
     1381 aatattctgg ttcttcagag aaaatagact tactggccag tgatcctcat gaggctttaa
     1441 tatgtaaaag tgaaagagtt cactccaaat cagtagagag taatattgaa gacaaaatat
     1501 ttgggaaaac ctatcggaag aaggcaagcc tccccaactt aagccatgta actgaaaatc
     1561 taattatagg agcatttgtt actgagccac agataataca agagcgtccc ctcacaaata
     1621 aattaaagcg taaaaggaga cctacatcag gccttcatcc tgaggatttt atcaagaaag
     1681 cagatttggc agttcaaaag actcctgaaa tgataaatca gggaactaac caaacggagc
     1741 agaatggtca agtgatgaat attactaata gtggtcatga gaataaaaca aaaggtgatt
     1801 ctattcagaa tgagaaaaat cctaacccaa tagaatcact cgaaaaagaa tctgctttca
     1861 aaacgaaagc tgaacctata agcagcagta taagcaatat ggaactcgaa ttaaatatcc
     1921 acaattcaaa agcacctaaa aagaataggc tgaggaggaa gtcttctacc aggcatattc
     1981 atgcgcttga actagtagtc agtagaaatc taagcccacc taattgtact gaattgcaaa
     2041 ttgatagttg ttctagcagt gaagagataa agaaaaaaaa gtacaaccaa atgccagtca
     2101 ggcacagcag aaacctacaa ctcatggaag gtaaagaacc tgcaactgga gccaagaaga
     2161 gtaacaagcc aaatgaacag acaagtaaaa gacatgacag cgatactttc ccagagctga
     2221 agttaacaaa tgcacctggt tcttttacta agtgttcaaa taccagtgaa cttaaagaat
     2281 ttgtcaatcc tagccttcca agagaagaaa aagaagagaa actagaaaca gttaaagtgt
     2341 ctaataatgc tgaagacccc aaagatctca tgttaagtgg agaaagggtt ttgcaaactg
     2401 aaagatctgt agagagtagc agtatttcat tggtacctgg tactgattat ggcactcagg
     2461 aaagtatctc gttactggaa gttagcactc tagggaaggc aaaaacagaa ccaaataaat
     2521 gtgtgagtca gtgtgcagca tttgaaaacc ccaagggact aattcatggt tgttccaaag
     2581 ataatagaaa tgacacagaa ggctttaagt atccattggg acatgaagtt aaccacagtc
     2641 gggaaacaag catagaaatg gaagaaagtg aacttgatgc tcagtatttg cagaatacat
     2701 tcaaggtttc aaagcgccag tcatttgctc cgttttcaaa tccaggaaat gcagaagagg
     2761 aatgtgcaac attctctgcc cactctgggt ccttaaagaa acaaagtcca aaagtcactt
     2821 ttgaatgtga acaaaaggaa gaaaatcaag gaaagaatga gtctaatatc aagcctgtac
     2881 agacagttaa tatcactgca ggctttcctg tggttggtca gaaagataag ccagttgata
     2941 atgccaaatg tagtatcaaa ggaggctcta ggttttgtct atcatctcag ttcagaggca
     3001 acgaaactgg actcattact ccaaataaac atggactttt acaaaaccca tatcgtatac
     3061 caccactttt tcccatcaag tcatttgtta aaactaaatg taagaaaaat ctgctagagg
     3121 aaaactttga ggaacattca atgtcacctg aaagagaaat gggaaatgag aacattccaa
     3181 gtacagtgag cacaattagc cgtaataaca ttagagaaaa tgtttttaaa gaagccagct
     3241 caagcaatat taatgaagta ggttccagta ctaatgaagt gggctccagt attaatgaaa
     3301 taggttccag tgatgaaaac attcaagcag aactaggtag aaacagaggg ccaaaattga
     3361 atgctatgct tagattaggg gttttgcaac ctgaggtcta taaacaaagt cttcctggaa
     3421 gtaattgtaa gcatcctgaa ataaaaaagc aagaatatga agaagtagtt cagactgtta
     3481 atacagattt ctctccatat ctgatttcag ataacttaga acagcctatg ggaagtagtc
     3541 atgcatctca ggtttgttct gagacacctg atgacctgtt agatgatggt gaaataaagg
     3601 aagatactag ttttgctgaa aatgacatta aggaaagttc tgctgttttt agcaaaagcg
     3661 tccagaaagg agagcttagc aggagtccta gccctttcac ccatacacat ttggctcagg
     3721 gttaccgaag aggggccaag aaattagagt cctcagaaga gaacttatct agtgaggatg
     3781 aagagcttcc ctgcttccaa cacttgttat ttggtaaagt aaacaatata ccttctcagt
     3841 ctactaggca tagcaccgtt gctaccgagt gtctgtctaa gaacacagag gagaatttat
     3901 tatcattgaa gaatagctta aatgactgca gtaaccaggt aatattggca aaggcatctc
     3961 aggaacatca ccttagtgag gaaacaaaat gttctgctag cttgttttct tcacagtgca
     4021 gtgaattgga agacttgact gcaaatacaa acacccagga tcctttcttg attggttctt
     4081 ccaaacaaat gaggcatcag tctgaaagcc agggagttgg tctgagtgac aaggaattgg
     4141 tttcagatga tgaagaaaga ggaacgggct tggaagaaaa taatcaagaa gagcaaagca
     4201 tggattcaaa cttaggtgaa gcagcatctg ggtgtgagag tgaaacaagc gtctctgaag
     4261 actgctcagg gctatcctct cagagtgaca ttttaaccac tcagcagagg gataccatgc
     4321 aacataacct gataaagctc cagcaggaaa tggctgaact agaagctgtg ttagaacagc
     4381 atgggagcca gccttctaac agctaccctt ccatcataag tgactcttct gcccttgagg
     4441 acctgcgaaa tccagaacaa agcacatcag aaaaagcagt attaacttca cagaaaagta
     4501 gtgaataccc tataagccag aatccagaag gcctttctgc tgacaagttt gaggtgtctg
     4561 cagatagttc taccagtaaa aataaagaac caggagtgga aaggtcatcc ccttctaaat
     4621 gcccatcatt agatgatagg tggtacatgc acagttgctc tgggagtctt cagaatagaa
     4681 actacccatc tcaagaggag ctcattaagg ttgttgatgt ggaggagcaa cagctggaag
     4741 agtctgggcc acacgatttg acggaaacat cttacttgcc aaggcaagat ctagagggaa
     4801 ccccttacct ggaatctgga atcagcctct tctctgatga ccctgaatct gatccttctg
     4861 aagacagagc cccagagtca gctcgtgttg gcaacatacc atcttcaacc tctgcattga
     4921 aagttcccca attgaaagtt gcagaatctg cccagagtcc agctgctgct catactactg
     4981 atactgctgg gtataatgca atggaagaaa gtgtgagcag ggagaagcca gaattgacag
     5041 cttcaacaga aagggtcaac aaaagaatgt ccatggtggt gtctggcctg accccagaag
     5101 aatttatgct cgtgtacaag tttgccagaa aacaccacat cactttaact aatctaatta
     5161 ctgaagagac tactcatgtt gttatgaaaa cagatgctga gtttgtgtgt gaacggacac
     5221 tgaaatattt tctaggaatt gcgggaggaa aatgggtagt tagctatttc tgggtgaccc
     5281 agtctattaa agaaagaaaa atgctgaatg agcatgattt tgaagtcaga ggagatgtgg
     5341 tcaatggaag aaaccaccaa ggtccaaagc gagcaagaga atcccaggac agaaagatct
     5401 tcagggggct agaaatctgt tgctatgggc ccttcaccaa catgcccaca gatcaactgg
     5461 aatggatggt acagctgtgt ggtgcttctg tggtgaagga gctttcatca ttcacccttg
     5521 gcacaggtgt ccacccaatt gtggttgtgc agccagatgc ctggacagag gacaatggct
     5581 tccatgcaat tgggcagatg tgtgaggcac ctgtggtgac ccgagagtgg gtgttggaca
     5641 gtgtagcact ctaccagtgc caggagctgg acacctacct gataccccag atcccccaca
     5701 gccactactg a
//