LOCUS       AH005384S4              2847 bp    DNA     linear   HUM 23-AUG-2002
DEFINITION  Homo sapiens interleukin-8 receptor type B (IL8) gene, exons 10,
            11, and complete cds.
ACCESSION   U11869
VERSION     U11869.1
KEYWORDS    .
SEGMENT     4 of 4
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2847)
  AUTHORS   Ahuja,S.K., Shetty,A., Tiffany,H.L. and Murphy,P.M.
  TITLE     Comparison of the genomic organization and promoter function for
            human interleukin-8 receptors A and B
  JOURNAL   J. Biol. Chem. 269 (42), 26381-26389 (1994)
   PUBMED   7929358
REFERENCE   2  (bases 1 to 2847)
  AUTHORS   Ahuja,S.K.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUL-1994) Sunil K. Ahuja, Laboratory of Host
            Defenses, National Institutes of Health, National Institute of
            Allergy and Infectious Diseases, NIH, Bldg 10, Rm 11N109, Bethesda,
            MD 20892, USA
FEATURES             Location/Qualifiers
     source          1..2847
                     /db_xref="H-InvDB:HIT000398666"
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2q34-35"
                     /clone="9I"
                     /tissue_type="placenta"
     gene            join(U11866.1:1064..2253,U11867.1:1..88,U11868.1:1..173,
                     1..2847)
                     /gene="IL8RB"
     mRNA            join(U11866.1:1064..1148,U11866.1:2077..2139,
                     U11867.1:20..71,1153..2847)
                     /gene="IL8RB"
                     /note="alternatively spliced variant IL8RB1, exons 1,6,8
                     and 11"
     mRNA            join(U11866.1:1492..1568,U11866.1:2077..2139,
                     U11867.1:20..71,1153..2847)
                     /gene="IL8RB"
                     /note="alternatively spliced variant IL8RB2, exons 2,6,8
                     and 11"
     mRNA            join(U11866.1:1806..1815,U11866.1:1856..2139,
                     U11867.1:20..71,1153..2847)
                     /gene="IL8RB"
                     /note="alternatively spliced variant IL8RB3, exons 3,5,6,8
                     and 11"
     mRNA            join(U11866.1:1816..1855,U11866.1:2077..2139,
                     U11867.1:20..71,1153..2847)
                     /gene="IL8RB"
                     /note="alternatively spliced variant IL8RB4, exons 4,6,8
                     and 11"
     mRNA            join(U11867.1:16..71,1153..2847)
                     /gene="IL8RB"
                     /note="alternatively spliced variant IL8RB7, exons 7,8 and
                     11"
     mRNA            join(U11868.1:16..168,1153..2847)
                     /gene="IL8RB"
                     /note="alternatively spliced variant IL8RB9, exons 9 and
                     11"
     intron          <1..971
                     /gene="IL8RB"
                     /number=5
     mRNA            972..2847
                     /gene="IL8RB"
                     /note="alternatively spliced variant IL8RB10, exons 10 and
                     11"
     exon            972..1152
                     /gene="IL8RB"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /number=10
     exon            1153..2847
                     /gene="IL8RB"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /number=11
     CDS             1178..2260
                     /gene="IL8RB"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="neutrophil chemoattractant receptor"
                     /codon_start=1
                     /product="interleukin-8 receptor type B"
                     /protein_id="AAB60656.1"
                     /db_xref="GI:511803"
                     /translation="MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESL
                     EINKYFVVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLP
                     IWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRY
                     LVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSF
                     GFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTL
                     MRTQVIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGL
                     ISKDSLPKDSRPSFVGSSSGHTSTTL"
BASE COUNT          727 a          758 c          629 g          733 t
ORIGIN      
        1 caccctccac acccaggctt ccccagagca ggatctgtgc tgtccctgtg gcaagggcag
       61 agccccagga gctagactaa atctgagagg aacaggggag tcaaggctag atggaggcac
      121 acatgcagga caggaagggt ctccagcagg gctgaaagca ccaagcaagg gtagtgcaaa
      181 ccctgtcttc tctgcttcct gctgcccctc tcttattggg tagcagactg gctgtgtctg
      241 cttatcccgc atggtggcac atggctgccc agagctcccc aaataacctg ttacgtttcc
      301 acccacaggg agaatcaggc agcccgcttg cttattgttt ttaatatact tttccaaact
      361 acacagacat tcccaaagcg ggtctccttc tacccaaaag agaaacgctg ggccttacta
      421 attaactgaa gactctgcta gctcgagcct tccaaaactc catgccacaa ttgttcaaac
      481 cattttccag aatacatctt ttaaaataac ttttagaaaa ttgaacaaag ggattcatgt
      541 ctcagcttta tagtcaaacc atgatctttt ctgagggtat agcccatttg gagttcctgc
      601 ttaatcccct gattaaaaac tgaatggggc tgagtgcagt gctcatgcct atattcccag
      661 cactttggga gacagaggca ggagaattac ttaaggtcag gagtttaaga ccatcctgag
      721 caacataaca agtccccatc tctaagacaa aaaaaaaaga actgagtgac atctcacatc
      781 tcacatttct gaacattaaa cccagccttg atagccaaag atgctcgcca ctgaaggatc
      841 caggtagtat tgagggttct gtggggatta tccaaagaga actttctaca aagttttagg
      901 tgatggcgat gctaaaagaa atgctaagaa tttctctctt atattaaaga gaactatggt
      961 cctctcataa aatgtaccat ttatcaccaa atttatctca taacctaaga gctaccactt
     1021 acaaatttga agggaaaaat tactacattg taatactcaa gccaacacaa agaatcctat
     1081 cccagtttct tgagtggatg ggcaagaata tggggaattt attatgcagt aaccttcatc
     1141 tctcttctat aggtcaggat ttaagtttac ctcaaaaatg gaagatttta acatggagag
     1201 tgacagcttt gaagatttct ggaaaggtga agatcttagt aattacagtt acagctctac
     1261 cctgccccct tttctactag atgccgcccc atgtgaacca gaatccctgg aaatcaacaa
     1321 gtattttgtg gtcattatct atgccctggt attcctgctg agcctgctgg gaaactccct
     1381 cgtgatgctg gtcatcttat acagcagggt cggccgctcc gtcactgatg tctacctgct
     1441 gaacctagcc ttggccgacc tactctttgc cctgaccttg cccatctggg ccgcctccaa
     1501 ggtgaatggc tggatttttg gcacattcct gtgcaaggtg gtctcactcc tgaaggaagt
     1561 caacttctat agtggcatcc tgctactggc ctgcatcagt gtggaccgtt acctggccat
     1621 tgtccatgcc acacgcacac tgacccagaa gcgctacttg gtcaaattca tatgtctcag
     1681 catctggggt ctgtccttgc tcctggccct gcctgtctta cttttccgaa ggaccgtcta
     1741 ctcatccaat gttagcccag cctgctatga ggacatgggc aacaatacag caaactggcg
     1801 gatgctgtta cggatcctgc cccagtcctt tggcttcatc gtgccactgc tgatcatgct
     1861 gttctgctac ggattcaccc tgcgtacgct gtttaaggcc cacatggggc agaagcaccg
     1921 ggccatgcgg gtcatctttg ctgtcgtcct catcttcctg ctctgctggc tgccctacaa
     1981 cctggtcctg ctggcagaca ccctcatgag gacccaggtg atccaggaga cctgtgagcg
     2041 ccgcaatcac atcgaccggg ctctggatgc caccgagatt ctgggcatcc ttcacagctg
     2101 cctcaacccc ctcatctacg ccttcattgg ccagaagttt cgccatggac tcctcaagat
     2161 tctagctata catggcttga tcagcaagga ctccctgccc aaagacagca ggccttcctt
     2221 tgttggctct tcttcagggc acacttccac tactctctaa gacctcctgc ctaagtgcag
     2281 cccgtggggt tcctcccttc tcttcacagt cacattccaa gcctcatgtc cactggttct
     2341 tcttggtctc agtgtcaatg cagcccccat tgtggtcaca ggaagtagag gaggccacgt
     2401 tcttactagt ttcccttgca tggtttagaa agcttgccct ggtgcctcac cccttgccat
     2461 aattactatg tcatttgctg gagctctgcc catcctgccc ctgagcccat ggcactctat
     2521 gttctaagaa gtgaaaatct acactccagt gagacagctc tgcatactca ttaggatggc
     2581 tagtatcaaa agaaagaaaa tcaggctggc caacgggatg aaaccctgtc tctactaaaa
     2641 atacaaaaaa aaaaaaaaaa attagccggg cgtggtggtg agtgcctgta atcacagcta
     2701 cttgggaggc tgagatggga gaatcacttg aacccgggag gcagaggttg cagtgagccg
     2761 agattgtgcc cctgcactcc agcctgagcg acagtgagac tctgtctcag tccatgaaga
     2821 tgtagaggag aaactggaac tctcgag
//