LOCUS       HSU10323                1552 bp    mRNA    linear   HUM 24-AUG-1994
DEFINITION  Human nuclear factor NF45 mRNA, complete cds.
ACCESSION   U10323
VERSION     U10323.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1552)
  AUTHORS   Kao,P.N., Chen,L., Brock,G., Ng,J., Kenny,J., Smith,A.J. and
            Corthesy,B.
  TITLE     Cloning and expression of cyclosporin A- and FK506-sensitive
            nuclear factor of activated T-cells: NF45 and NF90
  JOURNAL   J. Biol. Chem. 269 (32), 20691-20699 (1994)
   PUBMED   7519613
REFERENCE   2  (bases 1 to 1552)
  AUTHORS   Kao,P.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-1994) Peter N. Kao, Pulmonary and Critical Care
            Medicine, Stanford University, MSLS P312, Stanford, CA 94305-5487,
            USA
FEATURES             Location/Qualifiers
     source          1..1552
                     /db_xref="H-InvDB:HIT000217991"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="pBS II KS+ NF45.3"
                     /cell_line="Jurkat T-cell"
                     /clone_lib="2H Stim Jurkat T-cells, lambda gt11 cDNA
                     library from J.N. Northrop"
     CDS             40..1260
                     /function="involved in DNA-binding with NF90 protein to
                     NF-AT target DNA sequence in interleukin-2 enhancer"
                     /codon_start=1
                     /product="NF45 protein"
                     /protein_id="AAA20993.1"
                     /db_xref="GI:532313"
                     /translation="MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRV
                     KPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEV
                     RQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTN
                     ETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQS
                     TVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILA
                     AGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEG
                     DASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEENTERTTSRRGRRKHGNSGVT
                     FPSLLFLPKGKTGA"
BASE COUNT          422 a          357 c          374 g          399 t
ORIGIN      
        1 cggttggtgc ggcctccatt gttcgtgttt taaggcgcca tgaggggtga cagaggccgt
       61 ggtcgtggtg ggcgctttgg ttccagagga ggcccaggag gagggttcag gccctttgta
      121 ccacatatcc catttgactt ctatttgtgt gaaatggcct ttccccgggt caagccagca
      181 cctgatgaaa cttccttcag tgaggccttg ctgaagagga atcaggacct ggctcccaat
      241 tctgctgaac aggcatctat cctttctctg gtgacaaaaa taaacaatgt gattgataat
      301 ctgattgtgg ctccagggac atttgaagtg caaattgaag aagttcgaca ggtgggatcc
      361 tataaaaagg ggacaatgac tacaggacac aatgtggctg acctggtggt gatactcaag
      421 attctgccaa cgttggaagc tgttgctgcc ctggggaaca aagtcgtgga aagcctaaga
      481 gcacaggatc cttctgaagt tttaaccatg ctgaccaacg aaactggctt tgaaatcagt
      541 tcttctgatg ctacagtgaa gattctcatt acaacagtgc cacccaatct tcgaaaactg
      601 gatccagaac tccatttgga tatcaaagta ttgcagagtg ccttagcagc catccgacat
      661 gcccgctggt tcgaggaaaa tgcttctcag tccacagtta aagttctcat cagactactg
      721 aaggacttga ggattcgttt tcctggcttt gagcccctca caccctggat ccttgaccta
      781 ctaggccatt atgctgtgat gaacaacccc accagacagc ctttggccct aaacgttgca
      841 tacaggcgct gcttgcagat tctggctgca ggactgttcc tgccaggttc agtgggtatc
      901 actgacccct gtgagagtgg caactttaga gtacacacag tcatgaccct agaacagcag
      961 gacatggtct gctatacagc tcagactctc gtccgaatcc tctcacatgg tggctttagg
     1021 aagatccttg gccaggaggg tgatgccagc tatcttgctt ctgaaatatc tacctgggat
     1081 ggagtgatag taacaccttc agaaaaggct tatgagaagc caccagagaa gaaggaagga
     1141 gaggaagaag aggagaatac agaaagaacc acctcaagga gaggaagaag aaagcatgga
     1201 aactcaggag tgacattccc ttcactcctt ttcctaccca agggaaagac tggagcctaa
     1261 gctgcctgct actggcttta catggtgaca gacattccgt ggataggaag atagcaggag
     1321 aaagtaactc catagagtgt cattccactg gttgatattg gcttagctgc cagtctccca
     1381 tttgtgacct atgccatcca tctataatgg aggataccaa catttcttcc taatattcta
     1441 taatctccaa ctcctgaaaa cccctctctc aactaatact ttgctgttga aatgttgtga
     1501 aatgttaagt gtctggaaat ttttttttct aagaaaaact attaaagtac tt
//