LOCUS       HSU05012                2750 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens receptor tyrosine kinase TrkC (NTRK3) mRNA, complete
            cds.
ACCESSION   U05012
VERSION     U05012.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2750)
  AUTHORS   McGregor,L.M., Baylin,S.B., Griffin,C.A., Hawkins,A.L. and
            Nelkin,B.D.
  TITLE     Molecular cloning of the cDNA for human TrkC (NTRK3), chromosomal
            assignment, and evidence for a splice variant
  JOURNAL   Genomics 22 (2), 267-272 (1994)
   PUBMED   7806211
REFERENCE   2  (bases 1 to 2750)
  AUTHORS   McGregor,L.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-1994) Lisa M. McGregor, Johns Hopkins Medical
            Institutions, Oncology Center, 424 N. Bond Street, Baltimore, MD
            21231, USA
FEATURES             Location/Qualifiers
     source          1..2750
                     /db_xref="H-InvDB:HIT000217577"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q24-q25"
                     /clone="trkC"
                     /clone_lib="fetal brain cDNA"
     gene            1..2750
                     /gene="NTRK3"
     repeat_region   58..81
                     /note="trinucleotide"
                     /rpt_type=tandem
                     /satellite="microsatellite"
     repeat_region   58..60
     CDS             156..2633
                     /gene="NTRK3"
                     /codon_start=1
                     /product="receptor tyrosine kinase TrkC"
                     /protein_id="AAA75374.1"
                     /db_xref="GI:442390"
                     /translation="MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEIN
                     CRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELY
                     TGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQN
                     FFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVN
                     LTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSE
                     DNGFTLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLH
                     WLHNGQPLRESKIIHVEYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTIN
                     GHFLKEPFPESTDNFILFDEVSPTPPITVTHKPEEDTFGVSIAVGLAAFACVLLVVLF
                     VMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRI
                     PVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDK
                     MLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGD
                     LNKFLRAHGPNAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLAT
                     RNCLVGANLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVW
                     SFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQ
                     QRLNIKEIYKILHALGKATPIYLDILG"
BASE COUNT          638 a          783 c          732 g          597 t
ORIGIN      
        1 gatgcgagcc ggccaccagt cccggcagag ccactagggc ctctcgcggc tcccacccgg
       61 cggcggcggc ggcggcggcg gcgtccgcga tggtttcaga cgctgaagga ttttgcatct
      121 gatcgctcgg cgtttcaaag aagcagcgat cggagatgga tgtctctctt tgcccagcca
      181 agtgtagttt ctggcggatt ttcttgctgg gaagcgtctg gctggactat gtgggctccg
      241 tgctggcttg ccctgcaaat tgtgtctgca gcaagactga gatcaattgc cggcggccgg
      301 acgatgggaa cctcttcccc ctcctggaag ggcaggattc agggaacagc aatgggaacg
      361 ccagtatcaa catcacggac atctcaagga atatcacttc catacacata gagaactggc
      421 gcagtcttca cacgctcaac gccgtggaca tggagctcta caccggactt caaaagctga
      481 ccatcaagaa ctcaggactt cggagcattc agcccagagc ctttgccaag aacccccatt
      541 tgcgttatat aaacctgtca agtaaccggc tcaccacact ctcgtggcag ctcttccaga
      601 cgctgagtct tcgggaattg cagttggagc agaacttttt caactgcagc tgtgacatcc
      661 gctggatgca gctctggcag gagcaggggg aggccaagct caacagccag aacctctact
      721 gcatcaacgc tgatggctcc cagcttcctc tcttccgcat gaacatcagt cagtgtgacc
      781 ttcctgagat cagcgtgagc cacgtcaacc tgaccgtacg agagggtgac aatgctgtta
      841 tcacttgcaa tggctctgga tcaccccttc ctgatgtgga ctggatagtc actgggctgc
      901 agtccatcaa cactcaccag accaatctga actggaccaa tgttcatgcc atcaacttga
      961 cgctggtgaa tgtgacgagt gaggacaatg gcttcaccct gacgtgcatt gcagagaacg
     1021 tggtgggcat gagcaatgcc agtgttgccc tcactgtcta ctatccccca cgtgtggtga
     1081 gcctggagga gcctgagctg cgcctggagc actgcatcga gtttgtggtg cgtggcaacc
     1141 ccccaccaac gctgcactgg ctgcacaatg ggcagcctct gcgggagtcc aagatcatcc
     1201 atgtggaata ctaccaagag ggagagattt ccgagggctg cctgctcttc aacaagccca
     1261 cccactacaa caatggcaac tataccctca ttgccaaaaa cccactgggc acagccaacc
     1321 agaccatcaa tggccacttc ctcaaggagc cctttccaga gagcacggat aactttatct
     1381 tgtttgacga agtgagtccc acacctccta tcactgtgac ccacaaacca gaagaagaca
     1441 cttttggggt atccatagca gttggacttg ctgcttttgc ctgtgtcctg ttggtggttc
     1501 tcttcgtcat gatcaacaaa tatggtcgac ggtccaaatt tggaatgaag ggtcccgtgg
     1561 ctgtcatcag tggtgaggag gactcagcca gcccactgca ccacatcaac cacggcatca
     1621 ccacgccctc gtcactggat gcggggcccg acactgtggt cattggcatg actcgcatcc
     1681 ctgtcattga gaacccccag tacttccgtc agggacacaa ctgccacaag ccggacacgt
     1741 atgtgcagca cattaagagg agagacatcg tgctgaagcg agaactgggt gagggagcct
     1801 ttggaaaggt cttcctggcc gagtgctaca acctcagccc gaccaaggac aagatgcttg
     1861 tggctgtgaa ggccctgaag gatcccaccc tggctgcccg gaaggatttc cagagggagg
     1921 ccgagctgct caccaacctg cagcatgagc acattgtcaa gttctatgga gtgtgcggcg
     1981 atggggaccc cctcatcatg gtctttgaat acatgaagca tggagacctg aataagttcc
     2041 tcagggccca tgggccaaat gcaatgatcc ttgtggatgg acagccacgc caggccaagg
     2101 gtgagctggg gctctcccaa atgctccaca ttgccagtca gatcgcctcg ggtatggtgt
     2161 acctggcctc ccagcacttt gtgcaccgag acctggccac caggaactgc ctggttggag
     2221 cgaatctgct agtgaagatt ggggacttcg gcatgtccag agatgtctac agcacggatt
     2281 attacagggt gggaggacac accatgctcc ccattcgctg gatgcctcct gaaagcatca
     2341 tgtaccggaa gttcactaca gagagtgatg tatggagctt cggggtgatc ctctgggaga
     2401 tcttcaccta tggaaagcag ccatggttcc aactctcaaa cacggaggtc attgagtgca
     2461 ttacccaagg tcgtgttttg gagcggcccc gagtctgccc caaagaggtg tacgatgtca
     2521 tgctggggtg ctggcagagg gaaccacagc agcggttgaa catcaaggag atctacaaaa
     2581 tcctccatgc tttggggaag gccaccccaa tctacctgga cattcttggc tagtggtggc
     2641 tggtggtcat gaattcatac tctgttgcct cctctctccc tgcctcacat ctcccttcca
     2701 cctcacaact ccttccagcc ttgactgaag cgaacatctt catataaact
//