LOCUS       U01096                  2112 bp    DNA     linear   BCT 26-JUL-2016
DEFINITION  Streptomyces aureofaciens bromoperoxidase BPO-A1 (bpoA1) gene,
            complete cds.
ACCESSION   U01096
VERSION     U01096.1
KEYWORDS    .
SOURCE      Kitasatospora aureofaciens
  ORGANISM  Kitasatospora aureofaciens
            Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
            Kitasatospora.
REFERENCE   1  (bases 1 to 2112)
  AUTHORS   Pelletier,I., Pfeifer,O., Altenbuchner,J. and van Pee,K.H.
  TITLE     Cloning of a second non-haem bromoperoxidase gene from Streptomyces
            aureofaciens ATCC 10762: sequence analysis, expression in
            Streptomyces lividans and enzyme purification
  JOURNAL   Microbiology 140 (Pt 3), 509-516 (1994)
   PUBMED   8012573
REFERENCE   2  (bases 1 to 2112)
  AUTHORS   Weng,M., Pfeifer,O., Krauss,S., Lingens,F. and van Pee,K.H.
  TITLE     Purification, characterization and comparison of two non-haem
            bromoperoxidases from Streptomyces aureofaciens ATCC 10762
  JOURNAL   J. Gen. Microbiol. 137 (Pt 11), 2539-2546 (1991)
   PUBMED   1783900
REFERENCE   3  (bases 1 to 2112)
  AUTHORS   Altenbuchner,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-1993) Josef Altenbuchner, Institute of Industrial
            Genetics, University of Stuttgart, Allmandring 31, Stuttgart,
            70569, Germany
FEATURES             Location/Qualifiers
     source          1..2112
                     /organism="Kitasatospora aureofaciens"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10762"
                     /db_xref="ATCC:10762"
                     /db_xref="taxon:1894"
                     /clone="pOP1721"
     CDS             <1..357
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical 118 amino acid truncated protein
                     encoded by ORF1"
                     /protein_id="AAC43254.1"
                     /translation="KLAAVAVATLLAAGFGVTTAGSASAATSPSQLCGGYSTSEPMLS
                     QDDSGDAVKALQCELYNSLAYMGPDVDGYFGPKTLAAVQKFQTCTGLKPDGIVGPLTW
                     AKLDYQSSQGTTPVWC"
     repeat_region   622..662
                     /rpt_type=inverted
     gene            1044..1880
                     /gene="bpoA1"
     regulatory      1044..1047
                     /regulatory_class="ribosome_binding_site"
                     /gene="bpoA1"
     CDS             1053..1880
                     /gene="bpoA1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /codon_start=1
                     /transl_table=11
                     /product="bromoperoxidase BPO-A1"
                     /protein_id="AAC43253.1"
                     /translation="MPICTTRDGVEIFYKDWGQGRPVVFIHGWPLNGDAWQDQLKAVV
                     DAGYRGIAHDRRGHGHSTPVWDGYDFDTFADDLNDLLTDLDLRDVTLVAHSMGGGELA
                     RYVGRHGTGRLRSAVLLSAIPPVMIKSDKNPDGVPDEVFDALKNGVLTERSQFWKDTA
                     EGFFSANRPGNKVTQGNKDAFWYMAMAQTIEGGVRCVDAFGYTDFTEDLKKFDIPTLV
                     VHGDDDQVVPIDATGRKSAQIIPNAELKVYEGSSHGIAMVPGDKEKFNRDLLEFLNK"
BASE COUNT          354 a          768 c          668 g          322 t
ORIGIN      
        1 aagcttgcgg ccgttgcggt cgccaccctc ctggccgccg gcttcggtgt gaccaccgcc
       61 ggcagcgcct cggccgcgac gtccccgagc cagctctgcg gcggctacag caccagcgag
      121 ccgatgctct cccaggacga cagcggtgac gcggtcaagg ccttgcagtg cgagctctac
      181 aactccctcg cctacatggg cccggacgtc gacgggtact tcggccccaa gaccctcgcc
      241 gcggtgcaga agttccagac ctgcaccggt ctcaagcccg acggcatcgt cggcccgctg
      301 acctgggcca agctggacta ccagagcagc cagggcacca ccccggtctg gtgctaggcc
      361 ccacccctgg ggcccgtacg ccccgaatga ccacccagct cgcgaactga acgcctcctc
      421 cgccctcttc cccaccccct tcaacctgga cgtcgacggg cagttcggca agaacaccct
      481 cgccgcggtg aagaggttcc aggtgtgcgt caagctcccg gccgacggca tcgtcggccc
      541 gaacacctgg tccgagctgg acttctacgc caccgcgtgg aaaggggcga cctgctgacg
      601 atccgtcgcc gcaggggact gacgaagacg ctcggccgga ttctcccggc cgagcgtttt
      661 cgcgtacggc ccgtcgaacc gggcggcgac ccaccagcct gcccgcggga gggatacgac
      721 cgtactcgtt gccagccgtt cgttgccccg tcctcgtcag gagcacggcc gccggtaggg
      781 gtggtggccg gcgtacttct tccactggct ctcgggcacc ggggtaccgt ggcgcctcca
      841 ggcggccatg aggtcgaatc tccgtaggtc cttgaggcag ctgtcgtcgt gcttcggcga
      901 gtgtcggctc gatcggcggg cgggcaccac cccgtcacgt aggccatctg ggggtcggcg
      961 cttgcgcctg gtgcgggcat gcgttcggct ggcaagcgga tgcccgagca tccctcttcc
     1021 tcccgggcca cccaacacct tatggagacc acatgcccat ctgcaccacc cgcgacggtg
     1081 tcgagatctt ctacaaggac tggggccagg gacgtcccgt ggtgttcatc cacggctggc
     1141 cgctcaacgg cgacgcctgg caggaccagc tcaaggccgt cgtcgacgcc ggataccgcg
     1201 gaatcgcgca cgaccgccgc ggccacggac actccacgcc cgtctgggac ggctacgact
     1261 tcgacacctt cgccgacgac ctcaacgacc tgctcaccga cctcgacctg cgagatgtca
     1321 ccctggtcgc gcactccatg ggtggcggcg agctcgcgcg ctacgtcggc cgacacggca
     1381 cggggcggct gcgctcggcg gtgctgctgt ccgccatccc gccggtgatg atcaaatctg
     1441 acaagaatcc cgacggcgtg ccggacgagg tgttcgacgc actcaagaac ggcgtcctca
     1501 ccgagcgctc ccagttctgg aaggacactg cggagggctt cttctccgcc aaccgccccg
     1561 ggaacaaggt cacccagggc aacaaggatg ccttctggta catggcgatg gcgcagacca
     1621 tcgaaggcgg cgtgcggtgc gtggacgcct tcggttacac cgacttcacc gaagacctga
     1681 agaagttcga cattcccacc ctggtggtgc acggcgacga cgaccaggtc gtgcccatcg
     1741 acgccaccgg ccgcaagtcc gcccagatca tcccgaacgc cgagctgaag gtgtacgagg
     1801 gcagctccca cggcatcgcg atggtgccgg gcgacaagga gaagttcaac cgggacctgt
     1861 tggaattcct caacaagtag aaggcccagg cgaagtctca gccgacccgg acagccgcaa
     1921 ggtcttactc gccttcgccc aggacgacga aggaacggcc gccgcccgag ccctcgtact
     1981 cgggccggcc gacaccgagc agttcctgca cggcggcctc accctgcgcc ccgagaccgc
     2041 ggcaacactc gccgcttcac tgtgcggctg ggggttcggt tcctggttcg gcatgcgggc
     2101 cgggagggat cc
//