LOCUS       S74728                  1809 bp    mRNA    linear   HUM 05-MAY-1995
DEFINITION  antiquitin=26g turgor protein homolog [human, kidney, mRNA, 1809
            nt].
ACCESSION   S74728
VERSION     S74728.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1809)
  AUTHORS   Lee,P., Kuhl,W., Gelbart,T., Kamimura,T., West,C. and Beutler,E.
  TITLE     Homology between a human protein and a protein of the green garden
            pea
  JOURNAL   Genomics 21 (2), 371-378 (1994)
   PUBMED   8088832
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 158837] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..1809
                     /db_xref="H-InvDB:HIT000216559"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..1809
                     /gene="antiquitin"
     CDS             55..1590
                     /gene="antiquitin"
                     /note="26g turgor protein homolog; garden pea 26g turgor
                     protein homolog"
                     /codon_start=1
                     /product="antiquitin"
                     /protein_id="AAB31966.1"
                     /db_xref="GI:797410"
                     /translation="MSTLLINQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPA
                     NNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGS
                     LVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLV
                     GIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGA
                     ICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNAII
                     AFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNP
                     WDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD
                     ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDC
                     GIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGI
                     KFQ"
BASE COUNT          517 a          363 c          487 g          442 t
ORIGIN      
        1 cctgctccaa ggtccagaga gctttctggt ctttgcagca ggcctgccgc cttcatgtcc
       61 actctcctca tcaatcagcc ccagtatgcg tggctgaaag agctggggct ccgcgaggaa
      121 aacgagggcg tgtataatgg aagctgggga ggccggggag aggttattac gacctattgc
      181 cccgctaaca acgagccaat agcaagagtc cgacaggcca gtgtggcaga ctatgaagaa
      241 actgtaaaga aagcaagaga agcatggaaa atctgggcag atattcctgc tccaaaacga
      301 ggagaaatag taagacagat tggcgatgcc ttgcgggaga agatccaagt actaggaagc
      361 ttggtgtctt tggagatggg gaaaatctta gtggaaggtg tgggtgaagt tcaggagtat
      421 gtggatatct gtgactatgc tgttggttta tcaaggatga ttggaggacc tatcttgcct
      481 tctgaaagat ctggccatgc actgattgag cagtggaatc ccgtaggcct ggttggaatc
      541 atcacggcat tcaatttccc tgtggcagtg tatggttgga acaacgccat cgccatgatc
      601 tgtggaaatg tctgcctctg gaaaggagct ccaaccactt ccctcattag tgtggctgtc
      661 acaaagataa tagccaaggt tctggaggac aacaagctgc ctggtgcaat ttgttccttg
      721 acttgtggtg gagcagatat tggcacagca atggccaaag atgaacgagt gaacctgctg
      781 tccttcactg ggagcactca ggtgggaaaa caggtgggcc tgatggtgca ggagaggttt
      841 gggagaagtc tgttggaact tggaggaaac aatgccatta ttgcctttga agatgcagac
      901 ctcagcttag ttgttccatc agctctcttc gctgctgtgg gaacagctgg ccagaggtgt
      961 accactgcga ggcgactgtt tatacatgaa agcatccatg atgaggttgt aaacagactt
     1021 aaaaaggcct atgcacagat ccgagttggg aacccatggg accctaatgt tctctatggg
     1081 ccactccaca ccaagcaggc agtgagcatg tttcttggag cagtggaaga agcaaagaaa
     1141 gaaggtggca cagtggtcta tgggggcaag gttatggatc gccctggaaa ttatgtagaa
     1201 ccgacaattg tgacaggtct tggccacgat gcgtccattg cacacacaga gactttcgct
     1261 ccgattctct atgtctttaa attcaagaat gaagaagagg tctttgcatg gaataatgaa
     1321 gtaaaacagg gactttcaag tagcatcttt accaaagatc tgggcagaat ctttcgctgg
     1381 cttggaccta aaggatcaga ctgtggcatt gtaaatgtca acattccaac aagtggggct
     1441 gagattggag gtgcctttgg aggagaaaag cacactggtg gtggcaggga gtctggcagt
     1501 gatgcctgga aacagtacat gagaaggtct acttgtacta tcaactacag taaagacctt
     1561 cctctggccc aaggaatcaa gtttcagtaa aggtgtttta gatgaacatc ccttaatttg
     1621 aggtgttcca gcagctgttt ttggagaaga caaagaagat taaagttttc cctgaataaa
     1681 tgcattatta tgactgtgac agtgactaat ccccctatga ccccaaagcc ctgattaaat
     1741 caagagattc cttttttaaa aatcaaaata aaattgttac aacatagcca tagttactaa
     1801 aaaaaaaaa
//