LOCUS       S73483                   893 bp    mRNA    linear   HUM 02-MAR-1995
DEFINITION  phosphorylase kinase catalytic subunit PHKG2 homolog {Alu repeats}
            [human, somatic cell hybrid CY18, heteronuclear, mRNA Partial, 893
            nt].
ACCESSION   S73483
VERSION     S73483.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 893)
  AUTHORS   Whitmore,S.A., Apostolou,S., Lane,S., Nancarrow,J.K.,
            Phillips,H.A., Richards,R.I., Sutherland,G.R. and Callen,D.F.
  TITLE     Isolation and characterization of transcribed sequences from a
            chromosome 16 hn-cDNA library and the physical mapping of genes and
            transcribed sequences using a high-resolution somatic cell panel of
            human chromosome 16
  JOURNAL   Genomics 20 (2), 169-175 (1994)
   PUBMED   8020963
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 155652] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..893
                     /db_xref="H-InvDB:HIT000216477"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..893
                     /gene="phosphorylase kinase catalytic subunit PHKG2
                     homolog"
     CDS             1..313
                     /gene="phosphorylase kinase catalytic subunit PHKG2
                     homolog"
                     /codon_start=2
                     /protein_id="AAD14119.1"
                     /db_xref="GI:4261819"
                     /translation="DELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAV
                     KIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHISEAVFLDPVSRRPPTSCWPC
                     P"
BASE COUNT          166 a          289 c          219 g          219 t
ORIGIN      
        1 ggatgagctg cccgactggg ccgccgccaa agagttttac cagaagtacg accctaagga
       61 cgtcatcggc agaggagtga gctctgtggt ccgccgttgt gttcatcgag ctactggcca
      121 cgagtttgcg gtgaagatta tggaagtgac agctgagcgg ctgagtcctg agcagctgga
      181 ggaggtgcgg gaagccacac ggcgagagac acacatcctt cgccaggtcg ccggccaccc
      241 ccacatcagt gaggctgtct tccttgatcc tgttagcaga cgacctccca cctcctgctg
      301 gccctgccca tagcccactt ccgccaacat tgtctccaca cctctcctcc cttcattcca
      361 ctaaagagtg gccatccgtt gggcgcccac tgcctcctct tggttctcct tttcttccca
      421 gtaacagacc gctgctgttc cagggttggc caagcccccg ttaattgtgc atccaaactc
      481 cctttccaat ctctgtctct ctgcctctct tcctctctcc ctagtccacc ctcaacgatt
      541 cctagcgagt ctttctaaca tcatgttcct ggtgattgac ctgtgagtat ctccctgcca
      601 ccatctgaga agccctccac gccacctcca tgtatggccc agcatttgtg gtgcagtggg
      661 ctggacccat cctgctcaca ccttcctgtt ccagctgggg ctctctatca cctggacctg
      721 cctgctagcg catggctctg accttctccc ttggtgccat gattgaggca aattctttaa
      781 tagtgactag tggctgggta cagtggctca cgcctgtaat cccagcactt tgggagaccg
      841 agacgggtgg atcatgaggt caggagatcg agaccatcct ggctaacacg gtg
//
	

LOCUS       HUMPHK                  1571 bp    mRNA    linear   HUM 27-APR-1993
DEFINITION  Human phosphorylase kinase (PSK-C3) mRNA, complete cds.
ACCESSION   M31606
VERSION     M31606.1
KEYWORDS    phosphorylase kinase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1571)
  AUTHORS   Hanks,S.K.
  TITLE     Messenger ribonucleic acid encoding an apparent isoform of
            phosphorylase kinase catalytic subunit is abundant in the adult
            testis
  JOURNAL   Mol. Endocrinol. 3 (1), 110-116 (1989)
   PUBMED   2915644
COMMENT     Original source text: Human HeLa cell line, cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..1571
                     /db_xref="H-InvDB:HIT000195432"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HeLa"
     mRNA            <1..1571
                     /product="PSK-C3 mRNA"
     CDS             94..1314
                     /codon_start=1
                     /product="phosphorylase kinase"
                     /protein_id="AAA36442.1"
                     /db_xref="GI:189941"
                     /translation="MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHR
                     ATGHEFAVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSF
                     MFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENIL
                     LDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWA
                     CGVILFTLLAGSPPFWHRRQILMLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDP
                     EARLTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKN
                     ALLRDPYALRSVRHLIDNCAFRLYGHWVKKGEQQNRAALFQHRPPGPFPIMGPEEEGD
                     SAAITEDEAVLVLG"
BASE COUNT          327 a          468 c          455 g          321 t
ORIGIN      16 bp upstream of PstI site.
        1 aaggtgagcg actgcaggca aacccggcga cagcgcagct cgcgtcgacc ctggctcctc
       61 tgcctgcccc ctcaggcccc cgcctccttc aggatgacgc tggacgtggg gccggaggat
      121 gagctgcccg actgggccgc cgccaaagag ttttaccaga agtacgaccc taaggacgtc
      181 atcggcagag gagtgagctc tgtggtccgc cgttgtgttc atcgagctac tggccacgag
      241 tttgcggtga agattatgga agtgacagct gagcggctga gtcctgagca gctggaggag
      301 gtgcgggaag ccacacggcg agagacacac atccttcgcc aggtcgccgg ccacccccac
      361 atcatcaccc tcatcgattc ctacgagtct tctagcttca tgttcctggt gtttgacctg
      421 atgcggaagg gagagctgtt tgactatctc acagagaagg tggccctctc tgaaaaggaa
      481 accaggtcca tcatgcggtc tctgctggaa gcagtgagct ttctccatgc caacaacatt
      541 gtgcatcgag atctgaagcc cgagaatatt ctcctagatg acaatatgca gatccgactt
      601 tcagatttcg ggttctcctg ccacttggaa cctggcgaga agcttcgaga gttgtgtggg
      661 accccagggt atctagcgcc agagatcctt aaatgctcca tggatgaaac ccacccaggc
      721 tatggcaagg aggtcgacct ctgggcctgt ggggtgatct tgttcacact cctggctggc
      781 tcgccaccct tctggcaccg gcggcagatc ctgatgttac gcatgatcat ggagggccag
      841 taccagttca gttcccccga gtgggatgac cgttccagca ctgtcaaaga cctgatctcc
      901 aggctgctgc aggtggatcc tgaggcacgc ctgacagctg agcaggccct acagcacccc
      961 ttctttgagc gttgtgaagg cagccaaccc tggaacctca ccccccgcca gcggttccgg
     1021 gtggcagtgt ggacagtgct ggctgctgga cgagtggccc taagcaccca tcgtgtacgg
     1081 ccactgacca agaatgcact gttgagggac ccttatgcgc tgcggtcagt gcggcacctc
     1141 atcgacaact gtgccttccg gctctacggg cactgggtaa agaaagggga gcagcagaac
     1201 cgggcggctc tctttcagca ccggccccct gggccttttc ccatcatggg ccctgaagag
     1261 gagggagact ctgctgctat aactgaggat gaggccgtgc ttgtgctggg ctaggacctc
     1321 aaccccaggg attcccagga agcagaactc tccagaagaa gggttttgat cattccagct
     1381 cctctgggct ctggcctcag gcccactaat gatcctgcta ccctcttgaa gaccagcccg
     1441 gtacctctct ccccactggc caggactctg agatcagagc tggggtggaa gggagccatt
     1501 ctgaacgcca cgcctggccc ggtcagtgct gcatgcactg catatgaaat aaaatctgct
     1561 acacgccagg g
//