LOCUS       S40719                  3033 bp    mRNA    linear   HUM 08-MAY-1993
DEFINITION  glial fibrillary acidic protein [human, glioma cell line U-251 MG,
            mRNA, 3033 nt].
ACCESSION   S40719
VERSION     S40719.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3033)
  AUTHORS   Kumanishi,T., Usui,H., Ichikawa,T., Nishiyama,A., Katagiri,T.,
            Abe,S., Yoshida,Y., Washiyama,K., Kuwano,R., Sakimura,K. et al.
  TITLE     Human glial fibrillary acidic protein (GFAP): molecular cloning of
            the complete cDNA sequence and chromosomal localization (chromosome
            17) of the GFAP gene
  JOURNAL   Acta Neuropathol. 83 (6), 569-578 (1992)
   PUBMED   1636374
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 109455] from the original journal article.
FEATURES             Location/Qualifiers
     source          1..3033
                     /db_xref="H-InvDB:HIT000215579"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..3033
                     /gene="glial fibrillary acidic protein, GFAP"
     CDS             15..1313
                     /gene="glial fibrillary acidic protein, GFAP"
                     /note="GFAP"
                     /codon_start=1
                     /product="glial fibrillary acidic protein"
                     /protein_id="AAB22581.1"
                     /db_xref="GI:251802"
                     /translation="MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPP
                     PLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELN
                     QLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETN
                     LRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQ
                     QVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLR
                     QAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEE
                     GQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRET
                     SLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM"
BASE COUNT          666 a          866 c          926 g          575 t
ORIGIN      
        1 agagccagag caggatggag aggagacgca tcacctccgc tgctcgccgc tcctacgtct
       61 cctcagggga gatgatggtg gggggcctgg ctcctggccg ccgtctgggt cctggcaccc
      121 gcctctccct ggctcgaatg ccccctccac tcccgacccg ggtggatttc tccctggctg
      181 gggcactcaa tgctggcttc aaggagaccc gggccagtga gcgggcagag atgatggagc
      241 tcaatgaccg ctttgccagc tacatcgaga aggttcgctt cctggaacag caaaacaagg
      301 cgctggctgc tgagctgaac cagctgcggg ccaaggagcc caccaagctg gcagacgtct
      361 accaggctga gctgcgagag ctgcggctgc ggctcgatca actcaccgcc aacagcgccc
      421 ggctggaggt tgagagggac aatctggcac aggacctggc cactgtgagg cagaagctcc
      481 aggatgaaac caacctgagg ctggaagccg agaacaacct ggctgcctat agacaggaag
      541 cagatgaagc caccctggcc cgtctggatc tggagaggaa gattgagtcg ctggaggagg
      601 agatccggtt cttgaggaag atccacgagg aggaggttcg ggaactccag gagcagctgg
      661 cccgacagca ggtccatgtg gagcttgacg tggccaagcc agacctcacc gcagccctga
      721 aagagatccg cacgcagtat gaggcaatgg cgtccagcaa catgcatgaa gccgaagagt
      781 ggtaccgctc caagtttgca gacctgacag acgctgctgc ccgcaacgcg gagctgctcc
      841 gccaggccaa gcacgaagcc aacgactacc ggcgccagtt gcagtccttg acctgcgacc
      901 tggagtctct gcgcggcacg aacgagtccc tggagaggca gatgcgcgag caggaggagc
      961 ggcacgtgcg ggaggcggcc agttatcagg aggcgctggc gcggctggag gaagaggggc
     1021 agagcctcaa ggacgagatg gcccgccact tgcaggagta ccaggacctg ctcaatgtca
     1081 agctggccct ggacatcgag atcgccacct acaggaagct gctagagggc gaggagaacc
     1141 ggatcaccat tcccgtgcag accttctcca acctgcagat tcgagaaacc agcctggaca
     1201 ccaagtctgt gtcagaaggc cacctcaaga ggaacatcgt ggtgaagacc gtggagatgc
     1261 gggatggaga ggtcattaag gagtccaagc aggagcacaa ggatgtgatg tgaggcagga
     1321 cccacctggt ggcctctgcc ccgtctcatg aggggcccga gcagaagcag gatagttgct
     1381 ccgcctctgc tggcacattt ccccagacct gagctcccca ccaccccagc tgctcccctc
     1441 cctcctctgt ccctaggtca gcttgctgcc ctaggctccg tcagtatcag gcctgccaga
     1501 cggcacccac ccagcaccca gcaactccaa ctaacaagaa actcaccccc aagggcagtc
     1561 tggaggggca tggccagcag cttgcgttag aatgaggagg aaggagagaa ggggaggagg
     1621 gcggggggca cctactacat cgccctccac atccctgatt cctgttgtta tggaaactgt
     1681 tgccagagat ggaggttctc tcggagtatc tgggaactgt gcctttgagt ttcctcaggc
     1741 tgctggagga aaactgagac tcagacagga aagggaaggc cccacagaca aggtagccct
     1801 ggccagaggc ttgttttgtc ttttggtttt tatgaggtgg gatatcccta tgctgcctag
     1861 gctgaccttg aactcctggg ctcaagcagt ctacccacct cagcctcctg tgtagctggg
     1921 attatagatt ggagccacca tgcccagctc agagggttgt tctcctagac tgaccctgat
     1981 cagtctaaga tgggtgggga cgtcctgcca cctggggcag tcacctgccc agatcccaga
     2041 aggacctcct gagcgatgac tcaagtgtct cagtccacct gagctgccat ccagggatgc
     2101 catctgtggg cacgctgtgg gcaggtggga gcttgattct cagcacttgg gggatctgtt
     2161 gtgtacgtgg agagggatga ggtgctggga gggatagagg ggggctgcct ggcccccagc
     2221 tgtgggtaca gagaggtcaa gcccaggagg actgccccgt gcagactgga ggggacgctg
     2281 gtagagatgg aggaggaggc aattgggatg gcactaggca tacaagtagg ggttgtgggt
     2341 gaccagttgc acttggcctc tggattgtgg gaattaagga agtgactcat cctcttgaag
     2401 atgctgaaac aggagagaaa ggggatgtat ccatgggggc agggcatgac tttgtcccat
     2461 ttctaaaggc ctcttccttg ctgtgtcata ccaggccgcc ccagcctctg agcccctggg
     2521 actgctgctt cttaacccca gtaagccact gccacacgtc tgaccctctc caccccatag
     2581 tgaccggctg cttttcccta agccaagggc tcttgcggtc ccttcttact cacacacaaa
     2641 atgtacccag tattctaggt agtgccctat tttacaattg taaaactgag gcacgagcaa
     2701 agtgaagaca ctggctcata ttcctgcagc ctggaggccg ggtgctcagg gctgacacgt
     2761 ccaccccagt gcacccactc tgctttgact gagcagactg gtgagcagac tggtgggatc
     2821 tgtgcccaga gatgggactg ggagggccca cttcagggtt ctcctctccc ctctaaggcc
     2881 gaagaagggt ccttccctct ccccaagact tggtgtcctt tccctccact tcttcctgcc
     2941 acctgctgct gctgctgctg ctaatcttca gggcactgct gctgccttta gtcgctgagg
     3001 aaaaataaag acaaatgctg cgcccttaaa aaa
//