LOCUS       MW373995                 605 bp    DNA     linear   INV 30-APR-2021
DEFINITION  Neoacasta sp. WAM C58881 cytochrome c oxidase subunit I (COX1)
            gene, partial cds; mitochondrial.
ACCESSION   MW373995
VERSION     MW373995.1
KEYWORDS    .
SOURCE      mitochondrion Neoacasta sp. WAM C58881
  ORGANISM  Neoacasta sp. WAM C58881
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Hexanauplia; Cirripedia; Thoracica; Sessilia;
            Archaeobalanidae; Neoacasta.
REFERENCE   1  (bases 1 to 605)
  AUTHORS   Hosie,A.M., Fromont,J., Munyard,K., Wilson,N.G. and Jones,D.S.
  TITLE     Surveying keratose sponges (Porifera, Demospongiae, Dictyoceratida)
            reveals hidden diversity of host specialist barnacles (Crustacea,
            Cirripedia, Archaeobalanidae)
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 605)
  AUTHORS   Hosie,A.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2020) Aquatic Zoology, Western Australian Museum,
            49 Kew Street, Welshpool, WA 6106, Australia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..605
                     /organism="Neoacasta sp. WAM C58881"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /host="Carteriospongia foliascens"
                     /specimen_voucher="WAMC58881"
                     /db_xref="taxon:2796041"
                     /country="Australia"
                     /lat_lon="14.8476 S 124.7399 E"
     gene            <1..>605
                     /gene="COX1"
     CDS             <1..>605
                     /gene="COX1"
                     /codon_start=3
                     /transl_table=5
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="QPZ55415.1"
                     /translation="SAMVGTALSMLIRAELGQPGSLIGDDQIYNVIVTAHAFIMIFFM
                     VMPIMIGGFGNWLLPLMLGAPDMAFPRLNNMSFWLLPPALMLLISGSLVEAGAGTGWT
                     VYPPLSSNIAHSGASVDLSIFSLHLAGASSILGAINFMSTVINMRAETLTFDRLPLFV
                     WSVFITVILLLLSLPVLAGAITMLLTDRNLNTSFFDPTGGG"
BASE COUNT          175 a          106 c           99 g          225 t
ORIGIN      
        1 gatcagccat agttggaact gccttaagaa tactaattcg agctgaacta ggacaacctg
       61 gaagtctaat tggagatgac caaatttata acgtgattgt tacagcacac gcttttatta
      121 taattttttt catagtaata ccaattataa ttggaggatt tgggaattga cttctaccat
      181 taatattagg agccccagat atagcgtttc ctcgattaaa taatataagt ttttgacttc
      241 ttcctccagc tttaatactt ttaattagag ggtctttggt cgaagcagga gcaggaacag
      301 gatgaactgt ttatcctcct ttatcaagta atattgctca ctctggtgct tcagttgatt
      361 tatcaatttt ttctctacat ttagccggag cttcatctat tttaggagca attaatttta
      421 tatctacagt aattaatata cgagctgaaa ctttaacttt cgatcgtctt cctttatttg
      481 tatgaagtgt ttttattacc gtaattcttt tacttttatc cctcccagtt cttgctggag
      541 caattactat actacttact gatcgaaatt taaatacatc attttttgat ccaacaggag
      601 gagga
//