LOCUS       HUMERGBFLI              2957 bp    mRNA    linear   HUM 24-FEB-2000
DEFINITION  Homo sapiens ERGB transcription factor mRNA, complete cds.
ACCESSION   M98833
VERSION     M98833.3
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2957)
  AUTHORS   Watson,D.K., Smyth,F.E., Thompson,D.M., Cheng,J.Q., Testa,J.R.,
            Papas,T.S. and Seth,A.
  TITLE     The ERGB/Fli-1 gene: isolation and characterization of a new member
            of the family of human ETS transcription factors
  JOURNAL   Cell Growth Differ. 3 (10), 705-713 (1992)
   PUBMED   1445800
REFERENCE   2  (bases 1 to 2957)
  AUTHORS   Watson,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-AUG-1992) Center for Molecular and Structural
            Biology, Medical University of South Carolina, 86 Jonathan Lucas St
            PO Box 250956, Charleston, SC 29425, USA
REFERENCE   3  (bases 1 to 2957)
  AUTHORS   Watson,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2000) Center for Molecular and Structural
            Biology, Medical University of South Carolina, 86 Jonathan Lucas St
            PO Box 250956, Charleston, SC 29425, USA
  REMARK    Sequence update by submitter
COMMENT     On Feb 24, 2000 this sequence version replaced gi:7025920.
FEATURES             Location/Qualifiers
     source          1..2957
                     /db_xref="H-InvDB:HIT000197025"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="Chromosome 11, awaiting qualifier approval"
                     /cell_line="CEM"
                     /cell_type="T-cell"
                     /tissue_lib="lambda gt10"
     CDS             173..1531
                     /note="similar to FLI-1; DNA binding protein"
                     /codon_start=1
                     /product="ERGB transcription factor"
                     /protein_id="AAA35812.2"
                     /db_xref="GI:7025921"
                     /translation="MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQ
                     PHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNY
                     NSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQ
                     NMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKE
                     DPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANP
                     GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDK
                     LSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYH
                     AHQQKVNFVPPHPSSMPVTSSSFFGAASQYWTSPTGGIYPNPNVPRHPNTHVPSHLGS
                     YY"
     polyA_signal    2925..2930
BASE COUNT          855 a          698 c          680 g          724 t
ORIGIN      
        1 gaattcccaa acgtgcacag gggagtgagg gcagggcgct cgcagggggc acgcagggag
       61 ggcccagggc gccagggagg ccgcgccggg ctaatccgaa ggggctgcga ggtcaggctg
      121 taaccgggtc aatgtgtgga atattggggg gctcggctgc agacttggcc aaatggacgg
      181 gactattaag gaggctctgt cggtggtgag cgacgaccag tccctctttg actcagcgta
      241 cggagcggca gcccatctcc ccaaggccga catgactgcc tcggggagtc ctgactacgg
      301 gcagccccac aagatcaacc ccctcccacc acagcaggag tggatcaatc agccagtgag
      361 ggtcaacgtc aagcgggagt atgaccacat gaatggatcc agggagtctc cggtggactg
      421 cagcgttagc aaatgcagca agctggtggg cggaggcgag tccaacccca tgaactacaa
      481 cagctatatg gacgagaaga atggcccccc tcctcccaac atgaccacca acgagaggag
      541 agtcatcgtc cccgcagacc ccacactgtg gacacaggag catgtgaggc aatggctgga
      601 gtgggccata aaggagtaca gcttgatgga gatcgacaca tcctttttcc agaacatgga
      661 tggcaaggaa ctgtgtaaaa tgaacaagga ggacttcctc cgcgccacca ccctctacaa
      721 cacggaagtg ctgttgtcac acctcagtta cctcagggaa agttcactgc tggcctataa
      781 tacaacctcc cacaccgacc aatcctcacg attgagtgtc aaagaagacc cttcttatga
      841 ctcagtcaga agaggagctt ggggcaataa catgaattct ggcctcaaca aaagtcctcc
      901 ccttggaggg gcacaaacga tcagtaagaa tacagagcaa cggccccagc cagatccgta
      961 tcagatcctg ggcccgacca gcagtcgcct agccaaccct ggaagcgggc agatccagct
     1021 gtggcaattc ctcctggagc tgctctccga cagcgccaac gccagctgta tcacctggga
     1081 ggggaccaac ggggagttca aaatgacgga ccccgatgag gtggccaggc gctggggcga
     1141 gcggaaaagc aagcccaaca tgaattacga caagctgagc cgggccctcc gttattacta
     1201 tgataaaaac attatgacca aagtgcacgg caaaagatat gcttacaaat ttgacttcca
     1261 cggcattgcc caggctctgc agccacatcc gaccgagtcg tccatgtaca agtacccttc
     1321 tgacatctcc tacatgcctt cctaccatgc ccaccagcag aaggtgaact ttgtccctcc
     1381 ccatccatcc tccatgcctg tcacttcctc cagcttcttt ggagccgcat cacaatactg
     1441 gacctccccc acggggggaa tctaccccaa ccccaacgtc ccccgccatc ctaacaccca
     1501 cgtgccttca cacttaggca gctactacta gaagcttctt ctagctgaag cccatcctgc
     1561 acacttactg gatgctttgg actcaacagg acatatgtgg ccttgaaggg aagacaaaac
     1621 tggatgttct ttcttgttgg atagaacctt tgtatttgtt ctttaaaaac atttttttta
     1681 atgttggtaa cttttgcttc ctctacctga acaaagagat gaataattcc atgggccagt
     1741 atgccagttt gaattctcag tctcctagca tcttgtgagt tgcatattaa gattactgga
     1801 atggttaagt catggttctg agaaagaagc tgtacgtttt ctttatgttt ttatgaccaa
     1861 agcagtttct tgtcaataca cggggttcag tatgacacag aatcatggac ttaacccgtc
     1921 atgttctggt ttgagattta gtgacaaata gaggtgggaa gcttataatc taattttagg
     1981 aggaccaaat tcagcggatg gcaactggaa cattgattgt aaggccagtg aagttttcac
     2041 ccaactggaa tttgatggaa agaaggtttg tgtgtttaag acgccaaggg cattgcagaa
     2101 tccctctcag tggacagtat gcactcagct gaccactctc tctagaaata gtcaagatat
     2161 gaactaagaa attttaatgc aaatacatac attcctgaaa gacggggaat taaattacta
     2221 attttttttt tttaaatgat gacagtggtc ccagaacttg gaaaagttgt agggatttct
     2281 aaactcaagc agattcgcaa gtgctgtgcg cttgtcagac catcagacca gggccaacca
     2341 atcagaaggc aacttactgt ataaattatg cagagttatt ttcctatatc tcacagtatt
     2401 aaaaaataaa taattaaaaa ttaagaataa ataaacgagt tgacctcggt cacaaaagca
     2461 gttttactat cgaatcaatc gctgttattt ttttttaatg taatttgtac atcttttttc
     2521 aatctgtaca tttgggctgt cttgtatgtt tttatgctcc tttttaaaaa gcataatatg
     2581 cctatagctg aaaaggaaac agggctgttt aagtcactga cttatgagaa agcaaagcac
     2641 tggtacagtt atttaacagg catacacaag cagggaaaag ataatccatt tagatcttta
     2701 atgctttgga aatgcgtgta acagtactgc aataatcaca gctctgggaa aaacaacgaa
     2761 actttccctt gtggagagga gggattttcc tgctctatat aagcaacata tttttagaca
     2821 ttaaaatata tataattttg caggtaattg ttgacttttt taactatatt aagtgttaag
     2881 ctgacaactg tcaaagaaga ccatgttgta aaataatttg actaaataaa tggttccttc
     2941 tctcaaaaaa aaaaaaa
//