LOCUS       HUMHOX7                 1713 bp    mRNA    linear   HUM 08-NOV-1994
DEFINITION  Homo sapiens (region 7) homeobox protein (HOX7) mRNA, complete cds.
ACCESSION   M97676
VERSION     M97676.1
KEYWORDS    homeobox protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1713)
  AUTHORS   Padanilam,B.J., Stadler,H.S., Mills,K.A., McLeod,L.B., Solursh,M.,
            Lee,B., Ramirez,F., Buetow,K.H. and Murray,J.C.
  TITLE     Characterization of the human HOX 7 cDNA and identification of
            polymorphic markers
  JOURNAL   Hum. Mol. Genet. 1 (6), 407-410 (1992)
   PUBMED   1284527
COMMENT     Original source text: Homo sapiens (tissue library: lambda ZAP II;
            craniofacial) day 42-54 ectomesenchyme cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..1713
                     /db_xref="H-InvDB:HIT000196966"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="4p16.3-p16.1"
                     /tissue_type="ectomesenchyme"
                     /dev_stage="day 42-54"
                     /tissue_lib="lambda ZAP II; craniofacial"
     gene            1..1713
                     /gene="HOX7"
     5'UTR           1..240
                     /gene="HOX7"
                     /note="G00-120-683"
     CDS             241..1134
                     /gene="HOX7"
                     /codon_start=1
                     /product="homeobox protein"
                     /protein_id="AAA52683.1"
                     /db_xref="GI:184295"
                     /db_xref="GDB:G00-120-683"
                     /translation="MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGA
                     KPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDA
                     PSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTL
                     RKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRR
                     AKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAA
                     LPVAPVGLYTAHVGYSMYHLT"
     3'UTR           1135..1713
                     /gene="HOX7"
                     /note="G00-120-683"
BASE COUNT          350 a          568 c          531 g          264 t
ORIGIN      
        1 gcgcgagtgc tcccgggaac tctgcctgcg cggcggcagc gaccggaggc caggcccagc
       61 acgccggagc tggcctgctg gggaggggcg ggaggcgcgc gcgggagggt ccgcccggcc
      121 aggccccggg ccctcgcaga ggccggccgc gctcccagcc cgcccggagc ccatgcccgg
      181 cggctggcca gtgctgcggc agaagggggg gcccggctct gcatggcccc ggctgctgac
      241 atgacttctt tgccactcgg tgtcaaagtg gaggactccg ccttcggcaa gccggcgggg
      301 ggaggcgcgg gccaggcccc cagcgccgcc gcggccacgg cagccgccat gggcgcggac
      361 gaggaggggg ccaagcccaa agtgtcccct tcgctcctgc ccttcagcgt ggaggcgctc
      421 atggccgacc acaggaagcc gggggccaag gagagcgccc tggcgccctc cgagggcgtg
      481 caggcggcgg gtggctcggc gcagccactg ggcgtcccgc cggggtcgct gggagccccg
      541 gacgcgccct cttcgccgcg gccgctcggc catttctcgg tggggggact cctcaagctg
      601 ccagaagatg cgctcgtcaa agccgagagc cccgagaagc ccgagaggac cccgtggatg
      661 cagagccccc gcttctcccc gccgccggcc aggcggctga gccccccagc ctgcaccctc
      721 cgcaaacaca agacgaaccg taagccgcgg acgcccttca ccaccgcgca gctgctggcg
      781 ctggagcgca agttccgcca gaagcagtac ctgtccatcg ccgagcgcgc ggagttctcc
      841 agctcgctca gcctcactga gacgcaggtg aagatatggt tccagaaccg ccgcgccaag
      901 gcaaagagac tacaagaggc agagctggag aagctgaaga tggccgccaa gcccatgctg
      961 ccaccggctg ccttcggcct ctccttccct ctcggcggcc ccgcagctgt agcggccgcg
     1021 gcgggtgcct cgctctacgg tgcctctggc cccttccagc gcgccgcgct gcctgtggcg
     1081 cccgtgggac tctacacggc ccatgtgggc tacagcatgt accacctgac atagagggtc
     1141 ccaggtcccc acctgtgggc cagccgattc ctccagccct ggtgctgtac ccccgacgtg
     1201 ctcccctgct cggcaccgcc agccgccttc cctttaaccc tcacactgct ccagtttcac
     1261 ctctttgctc cctgagttca ctctccgaag tctgatccct gccaaaaagt ggctggaaga
     1321 gtcccttagt actcttctag catttagatc tacactctcg agttaaagat ggggaaactg
     1381 agggcagaga ggttaacaga tttatctagg gtccccagca gaattgacag ttgaacagag
     1441 ctagaggcca tgtctcctgc atagcttttc cctgtcctga caccaggcaa gaaaagcgca
     1501 gagaaatcgg tgtctgacga ttttggaaat gagaacaatc tcaaaaaaaa aaaaaaaaaa
     1561 aaaaaaaaaa gaaaagagaa aaaaaagact agccagccag gaagatgaat cctagcttct
     1621 tccattggaa aatttaagac aagttcaaca acaaaacatt tgctctgggg ggcagggaaa
     1681 acacagatgt gttgcaaagg taggttgaag gga
//