LOCUS       ATHPABP                 3246 bp    DNA     linear   PLN 10-SEP-1993
DEFINITION  Arabidopsis thaliana poly(A)-binding protein (PAB5) gene, complete
            cds.
ACCESSION   M97657
VERSION     M97657.1
KEYWORDS    poly(A)-binding protein.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 3246)
  AUTHORS   Belostotsky,D.A. and Meagher,R.B.
  TITLE     Differential organ-specific expression of three
            poly(A)-binding-protein genes from Arabidopsis thaliana
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (14), 6686-6690 (1993)
   PUBMED   8341686
COMMENT     Original source text: Arabidopsis thaliana (strain Columbia)
            immature flower buds DNA.
FEATURES             Location/Qualifiers
     source          1..3246
                     /organism="Arabidopsis thaliana"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3702"
                     /tissue_type="immature flower buds"
                     /ecotype="Columbia"
     mRNA            join((45.46)..529,699..1480,1576..1653,1748..1837,
                     1938..2258,2367..2579,2678..3177)
                     /gene="PAB5"
                     /product="poly(A)-binding protein"
     exon            (45.46)..529
                     /gene="PAB5"
                     /number=1
     gene            join(238..529,699..1480,1576..1653,1748..1837,1938..2258,
                     2367..2579,2678..2908)
                     /gene="PAB5"
     CDS             join(238..529,699..1480,1576..1653,1748..1837,1938..2258,
                     2367..2579,2678..2908)
                     /gene="PAB5"
                     /codon_start=1
                     /product="poly(A)-binding protein"
                     /protein_id="AAA32832.1"
                     /translation="MVDQVIPNQPTVAAAAPPPFPAVSQVAAVAAAAAAAEALQTHPN
                     SSLYVGDLDPSVNESHLLDLFNQVAPVHNLRVCRDLTHRSLGYAYVNFANPEDASRAM
                     ESLNYAPIRDRPIRIMLSNRDPSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTILS
                     CKVAMDVVGRSKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFVGHFVRRQDRARSES
                     GAVPSFTNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSPE
                     AAAVAVEKMNGISLGEDVLYVGRAQKKSDREEELRRKFEQERISRFEKLQGSNLYLKN
                     LDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKEMNGKM
                     IGRKPLYVALAQRKEERQAHLQSLFTQIRSPGTMSPVPSPMSGFHHHPPGGPMSGPHH
                     PMFIGHNGQGLVPSQPMGYGYQVQFMPGMRPGAGPPNFMMPFPLQRQTQPGPRVGFRR
                     GANNMQQQFQQQQMLQQNASRFMGGAGNRRNGMEASAPQGIIPLPLNASANSHNAPQR
                     SHKPTPLTISKLASDLALASPDKHPRMLGDHLYPLVEQQEPANPAKVTGMLLEMDQAE
                     ILHLLESPEALKAKVSEALDVLRRSADPAAVSSVDDQFALSSSE"
     intron          530..698
                     /number=1
     exon            699..1480
                     /gene="PAB5"
                     /number=2
     intron          1481..1575
                     /number=2
     exon            1576..1653
                     /gene="PAB5"
                     /number=3
     intron          1654..1747
                     /number=3
     exon            1748..1837
                     /gene="PAB5"
                     /number=4
     intron          1838..1937
                     /number=4
     exon            1938..2258
                     /gene="PAB5"
                     /number=5
     intron          2259..2366
                     /number=5
     exon            2367..2579
                     /gene="PAB5"
                     /number=6
     intron          2580..2677
                     /number=6
     exon            2678..3177
                     /gene="PAB5"
                     /number=7
     polyA_site      3058..3059
                     /gene="PAB5"
     polyA_site      3130
                     /gene="PAB5"
     polyA_site      3175
                     /gene="PAB5"
BASE COUNT          847 a          645 c          697 g         1057 t
ORIGIN      
        1 tagcgaatgt ataaatacca actctcattc tttcacaccc tttcgagtct ctctactcct
       61 cttcttattc accggagtaa cccaaaaaaa aaaaggaaaa aatataaaaa taaatattct
      121 cccctaaaaa ttttggaaaa ccacaaacag aaatctctct gtctcaccct agaaaaacct
      181 agaaatctta tcgctatggc tgcggcggtt gcatctggaa ttgccccgac gacggccatg
      241 gttgatcaag tgatccctaa tcaacccacg gttgctgctg ctgctcctcc tcctttccct
      301 gccgtgagtc aggttgcggc ggttgctgct gctgctgctg cagcggaggc tttgcaaacc
      361 catccaaact cgtctctcta tgtcggagat ttagatccga gtgtcaatga gtcacatctc
      421 ttggatctct ttaatcaagt tgctccagtt cacaatctta gggtttgtcg tgatctgact
      481 catcgttctc ttggttacgc ttacgtcaat ttcgctaacc ctgaagatgg taaatattat
      541 aaacaatcat acaggaattt aatattatta ttatggatta cgacaggaat ataatattgt
      601 tcatgtgttt gcttttgtgg ttttgttctt tttgctgttt tgttttgttt tgttttgctg
      661 ttttgtaatt aaagttttgt gtttttttat tggatcagcg agtcgtgcga tggaaagtct
      721 caactatgct ccgatcagag acaggcctat aaggatcatg ctctctaatc gtgatccgag
      781 cactagattg agtgggaaag gcaatgtttt catcaaaaac cttgatgcat cgattgataa
      841 caaagctttg tatgaaactt tctcgtcttt cgggacgatt ctctcttgca aggttgcaat
      901 ggatgtggtg ggacgttcga aaggatatgg ctttgtccag tttgagaaag aggaaaccgc
      961 tcaggctgct attgacaagc ttaatggtat gttgcttaat gataagcaag tctttgttgg
     1021 ccattttgtc cgtcgtcaag acagggcacg tagtgagagt ggtgcggtgc cgagcttcac
     1081 taacgtttat gttaagaatc ttcctaagga gattactgat gatgagctta agaagacttt
     1141 tgggaaatat ggagatattt ctagtgcggt tgtgatgaag gatcagagtg ggaactcgag
     1201 gtctttcggg tttgtcaact ttgtgagccc tgaagctgct gcagttgctg ttgaaaagat
     1261 gaacggtatc agccttgggg aggatgtgtt gtatgttggt agggcacaga agaagtctga
     1321 tagggaagag gaattgagga ggaagtttga gcaagagagg ataagcaggt ttgagaaatt
     1381 gcaaggatcg aatctgtatt tgaagaacct tgatgatagt gtgaatgatg agaagctcaa
     1441 ggagatgttc tctgagtatg ggaatgtgac ttcctgcaag gtttgtttct gattctaaac
     1501 atctctaaac tttatacata agtttatacc acacaatata atgaattaaa atgttttgtt
     1561 tgtggtcata attaggttat gatgaattca caaggtttaa gcagaggttt tggttttgtt
     1621 gcttactcca atcctgaaga agctttatta gctgtaagtt tcaactgaat tgacaatctt
     1681 tttacatata cataaatgtt ttataaaatt ggtactaaaa tgttcattgg ggttgatgat
     1741 tacgcagatg aaagaaatga atgggaagat gataggaagg aaacctcttt acgttgcttt
     1801 ggcacaacgt aaggaagaaa gacaggctca ccttcaggtt ctttttagcc ctctcactct
     1861 ttgaacatca aactctgtac tgtgttgtgt tgtgacactg agttcttaaa ctgtcttgat
     1921 gttttcacgt gtttcagagt ctatttactc aaatcagatc acctggaaca atgtcaccag
     1981 ttccatcacc gatgtctggg ttccatcatc acccaccagg tgggccaatg tcaggaccac
     2041 accatccaat gttcataggc cataacggtc aaggtttggt accttcacag cctatggggt
     2101 atgggtacca agttcagttc atgcctggga tgcgtccagg tgcaggcccg cctaacttca
     2161 tgatgccttt ccctcttcaa aggcaaactc agcctggccc tcgtgttggg ttcaggcgtg
     2221 gtgctaataa catgcagcag cagtttcagc aacaacaagt aaagttttta tcattagttc
     2281 ttatgtcttt tagcaagttt attatcttta acacaatcat acgaatatga atttgttggg
     2341 gcttgttatt atcttggaac tgtcagatgc tgcagcaaaa tgcaagcaga ttcatgggag
     2401 gcgcaggcaa caggaggaat ggaatggaag catctgctcc acaaggcatc atccctttgc
     2461 cattgaatgc atctgcaaac tctcacaatg ctccgcaacg ctctcacaag ccaactcccc
     2521 tcaccatttc taagctcgca tctgatttgg ctttggctag ccccgacaaa cacccacggg
     2581 ttagtgatct cctgtgtttt cttctcttat ctcatttagt acttgcatta taacctatat
     2641 ttgttaacaa tatcattgca ttgtgaattg atgacagatg cttggggatc atctttaccc
     2701 acttgtggag cagcaggagc cagcaaatcc tgctaaagtt accgggatgt tgctggagat
     2761 ggatcaagct gagattttgc accttcttga gtcacctgaa gctcttaagg ctaaagtgtc
     2821 cgaggctctg gatgttctca gacgctctgc tgatccagca gctgtgtcat ctgttgatga
     2881 ccagtttgct ctatcctcat ccgagtgaac atactgttta ctcaagacta tgtttctctc
     2941 gctttcttag acagttgctt taataccttt taggaccttt aaaactagct ttttcttttc
     3001 tacatctctt tgatagattg ttttgagttt ttcccttagc attgagactt ttactcttta
     3061 gcactttctc tagtttcgtt aggagtctat ttaatgtgtc aactcttttg caactccaaa
     3121 ttcgtttcag aaactttaca tttagcattt tatctaataa tcggcattct ggttaaacat
     3181 tctgagtata tgaaatctgg atgtacctcg ttgtctacta tctgatattc cgtatttatc
     3241 tccatt
//