LOCUS       HSHMPLP                 1908 bp    mRNA    linear   HUM 18-JUL-1995
DEFINITION  Human (clones 15, 39, 41) c-myeloproliferative leukemia virus type
            P (c-mpl-P) mRNA, complete cds.
ACCESSION   M90102
VERSION     M90102.1
KEYWORDS    c-myeloproliferative leukemia virus; hematopoietic growth factor
            receptor; transmembrane protein; v-myeloproliferative leukemia
            virus cellular oncogene homologue.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1908)
  AUTHORS   Vigon,I., Mornon,J.P., Cocault,L., Mitjavila,M.T., Tambourin,P.,
            Gisselbrecht,S. and Souyri,M.
  TITLE     Molecular cloning and characterization of MPL, the human homolog of
            the v-mpl oncogene: identification of a member of the hematopoietic
            growth factor receptor superfamily
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 89 (12), 5640-5644 (1992)
   PUBMED   1608974
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..1908
                     /db_xref="H-InvDB:HIT000196762"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p34"
                     /cell_line="HEL"
     gene            1..1908
                     /gene="c-mpl-P"
     CDS             1..1908
                     /gene="c-mpl-P"
                     /note="bp 1-1566 are common to c-mpl-K and c-mpl-P"
                     /codon_start=1
                     /product="c-myeloproliferative leukemia virus type P"
                     /protein_id="AAA69971.1"
                     /db_xref="GI:184261"
                     /translation="MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRT
                     FEDLTCFWDEEEAAPSGTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVR
                     LFFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPE
                     ISDFLRYELRYGPRDPKNSTGPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPW
                     QDGPKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPV
                     TVDLPGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRARCCPRDRYPIWENC
                     EEEEKTNPGLQTPQFSRCHFKSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVRLP
                     TPNLHWREISSGHLELEWQHPSSWAAQETCYQLRYTGEGHQDWKVLEPPLGARGGTLE
                     LRPRSRYRLQLRARLNGPTYQGPWSSWSDPTRVETATETAWISLVTALHLVLGLSAVL
                     GLLLLRWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALSPPKATVSDTCEEVEPS
                     LLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANH
                     SYLPLSYWQQP"
     sig_peptide     7..24
                     /gene="c-mpl-P"
     mat_peptide     25..579
                     /gene="c-mpl-P"
                     /product="unnamed"
     misc_signal     269..273
                     /gene="c-mpl-P"
                     /note="degenerated WS box"
     misc_signal     473..478
                     /gene="c-mpl-P"
                     /note="WS box"
BASE COUNT          396 a          629 c          500 g          383 t
ORIGIN      
        1 atgccctcct gggccctctt catggtcacc tcctgcctcc tcctggcccc tcaaaacctg
       61 gcccaagtca gcagccaaga tgtctccttg ctggcatcag actcagagcc cctgaagtgt
      121 ttctcccgaa catttgagga cctcacttgc ttctgggatg aggaagaggc agcgcccagt
      181 gggacatacc agctgctgta tgcctacccg cgggagaagc cccgtgcttg ccccctgagt
      241 tcccagagca tgccccactt tggaacccga tacgtgtgcc agtttccaga ccaggaggaa
      301 gtgcgtctct tctttccgct gcacctctgg gtgaagaatg tgttcctaaa ccagactcgg
      361 actcagcgag tcctctttgt ggacagtgta ggcctgccgg ctccccccag tatcatcaag
      421 gccatgggtg ggagccagcc aggggaactt cagatcagct gggaggagcc agctccagaa
      481 atcagtgatt tcctgaggta cgaactccgc tatggcccca gagatcccaa gaactccact
      541 ggtcccacgg tcatacagct gattgccaca gaaacctgct gccctgctct gcagaggcct
      601 cactcagcct ctgctctgga ccagtctcca tgtgctcagc ccacaatgcc ctggcaagat
      661 ggaccaaagc agacctcccc aagtagagaa gcttcagctc tgacagcaga gggtggaagc
      721 tgcctcatct caggactcca gcctggcaac tcctactggc tgcagctgcg cagcgaacct
      781 gatgggatct ccctcggtgg ctcctgggga tcctggtccc tccctgtgac tgtggacctg
      841 cctggagatg cagtggcact tggactgcaa tgctttacct tggacctgaa gaatgttacc
      901 tgtcaatggc agcaacagga ccatgctagc tcccaaggct tcttctacca cagcagggca
      961 cggtgctgcc ccagagacag gtaccccatc tgggagaact gcgaagagga agagaaaaca
     1021 aatccaggac tacagacccc acagttctct cgctgccact tcaagtcacg aaatgacagc
     1081 attattcaca tccttgtgga ggtgaccaca gccccgggta ctgttcacag ctacctgggc
     1141 tcccctttct ggatccacca ggctgtgcgc ctccccaccc caaacttgca ctggagggag
     1201 atctccagtg ggcatctgga attggagtgg cagcacccat cgtcctgggc agcccaagag
     1261 acctgttatc aactccgata cacaggagaa ggccatcagg actggaaggt gctggagccg
     1321 cctctcgggg cccgaggagg gaccctggag ctgcgcccgc gatctcgcta ccgtttacag
     1381 ctgcgcgcca ggctcaacgg ccccacctac caaggtccct ggagctcgtg gtcggaccca
     1441 actagggtgg agaccgccac cgagaccgcc tggatctcct tggtgaccgc tctgcatcta
     1501 gtgctgggcc tcagcgccgt cctgggcctg ctgctgctga ggtggcagtt tcctgcacac
     1561 tacaggagac tgaggcatgc cctgtggccc tcacttccag acctgcaccg ggtcctaggc
     1621 cagtacctta gggacactgc agccctgagc ccgcccaagg ccacagtctc agatacctgt
     1681 gaagaagtgg aacccagcct ccttgaaatc ctccccaagt cctcagagag gactcctttg
     1741 cccctgtgtt cctcccaggc ccagatggac taccgaagat tgcagccttc ttgcctgggg
     1801 accatgcccc tgtctgtgtg cccacccatg gctgagtcag ggtcctgctg taccacccac
     1861 attgccaacc attcctacct accactaagc tattggcagc agccttga
//