LOCUS       AMADEL                  2075 bp    mRNA    linear   PLN 05-APR-2001
DEFINITION  Antirrhinum majus DEL (delila) mRNA, complete cds.
ACCESSION   M84913
VERSION     M84913.1
KEYWORDS    .
SOURCE      Antirrhinum majus (snapdragon)
  ORGANISM  Antirrhinum majus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Lamiales; Plantaginaceae;
            Antirrhineae; Antirrhinum.
REFERENCE   1  (bases 1 to 2075)
  AUTHORS   Goodrich,J., Carpenter,R. and Coen,E.S.
  TITLE     A common gene regulates pigmentation pattern in diverse plant
            species
  JOURNAL   Cell 68 (5), 955-964 (1992)
   PUBMED   1547495
FEATURES             Location/Qualifiers
     source          1..2075
                     /organism="Antirrhinum majus"
                     /mol_type="mRNA"
                     /strain="JI 75"
                     /db_xref="taxon:4151"
                     /tissue_type="corolla"
                     /dev_stage="flower bud"
     gene            1..2075
                     /gene="delila"
     CDS             25..1959
                     /gene="delila"
                     /note="DNA-binding protein; regulatory protein"
                     /codon_start=1
                     /product="DEL"
                     /protein_id="AAA32663.1"
                     /translation="MATGIQNQKIVPENLRKQLAIAVRSIQWSYAIFWSNSVAQPGVL
                     EWGDGFYNGDIKTRKTVQSVELNQDQLGLQRSDQLRELYESLSLGETNTQAKRPTAAL
                     SPEDLTDAEWFFLVCMSFIFNIGQGLPGRTLARNQAVWLCNAHRADTKVFSRSLLAKS
                     ASIQTVVCFPYSEGVVELGATELVPEDLNLIQHIKTSFLDSPATVPKIPNYVSNSITN
                     NNDLICEALEHANIPENDLDQLLNCPDTNICSPDNSLDDFADNLLIDESNLAEGINGE
                     VPQTQSWPFMDDAISNCLNSSMNSSDCISQTHENLESFAPLSDGKGPPETNNCMHSTQ
                     KCNQQIENTGVQGDEVHYQGVLSNLLKSSHQLVLGPYFRNGNRESSFVSWNKDGSSGT
                     HVPRSGTSQRFLKKVLFEVARMHENSRLDAGKQKGNSDCLAKPTADEIDRNHVLSERK
                     RREKINERFMILASLVPSGGKVDKVSILDHTIDYLRGLERKVDELESNKMVKGRGRES
                     TTKTKLHDAIERTSDNYGATRTSNVKKPLTNKRKASDTDKIGAVNSRGRLKDSLTDNI
                     TVNITNKDVLIVVTCSSKEFVLLEVMEAVRRLSLDSETVQSSNRDGMISITIKAKCKG
                     LKVASASVIKQALQKVTMKS"
BASE COUNT          673 a          388 c          468 g          546 t
ORIGIN      
        1 gtagagagga gagaggattc aagaatggct actggtatcc aaaaccaaaa gatagtgcct
       61 gagaatttga ggaagcaact tgctattgct gtgagaagta tccaatggag ttatgcaatt
      121 ttctggtcca attcagttgc acaaccaggg gtcttggagt ggggtgatgg gttctacaat
      181 ggagatatta aaactcgaaa aactgtacaa tctgtcgaat tgaatcaaga tcagctggga
      241 ttgcagagaa gtgatcaatt gagagaactt tatgagtctc tttcacttgg tgaaaccaac
      301 acacaagcta aaaggcctac tgctgcatta tcaccagaag acctcactga tgctgagtgg
      361 tttttcttgg tttgcatgtc tttcatattc aatattggcc aagggttgcc tggaagaaca
      421 ttagcacgaa atcaagcagt atggctatgc aacgctcatc gtgcggacac caaagttttc
      481 tcgcgttctt tgcttgcaaa gagtgcgtca attcagacag ttgtgtgctt tccatattca
      541 gaaggtgtag ttgagctggg agcaacagag ctagtaccgg aggatttgaa tctaatccag
      601 catataaaaa cttcattctt ggacagtcct gccaccgttc ccaagattcc caactatgtc
      661 tccaacagta ttacaaacaa caatgacctc atttgtgaag cgcttgaaca tgctaatata
      721 ccagaaaacg atcttgatca gcttttgaat tgtccagaca cgaacatatg ttctcctgat
      781 aacagtttgg atgactttgc agacaattta ctcatagacg aatcgaattt ggcagaaggc
      841 atcaatgggg aggttcctca aacacaaagc tggcctttca tggatgatgc aatcagcaat
      901 tgtctcaata gttctatgaa ttctagtgac tgtatatctc aaactcatga aaatctagag
      961 tcttttgctc cactttctga tggaaaaggg ccaccggaga cgaataattg tatgcacagc
     1021 actcaaaaat gcaatcagca gatagaaaac acgggtgtcc aaggcgatga ggtccattat
     1081 caaggggtac tttccaatct tttgaagagt tcccatcagt tggttcttgg tccctacttc
     1141 agaaatggga atagagaatc aagcttcgtt agttggaaca aggatggatc gtcgggtact
     1201 catgttcccc gaagcggaac ctcacaaaga tttctgaaga aagtactttt tgaagtagct
     1261 agaatgcatg aaaactccag gcttgatgct ggtaaacaaa agggcaacag tgactgcctt
     1321 gcaaagccaa cggctgatga aattgataga aaccacgtct tgtcagagag aaaacgcaga
     1381 gagaaaataa acgaacggtt tatgattctt gcatccctag tcccatccgg tggcaaggtt
     1441 gacaaagtat caatactaga ccatacaata gattacttga gagggcttga gaggaaagtc
     1501 gacgagctgg aatctaacaa aatggtaaag ggccgggggc gggaatcaac tacaaaaact
     1561 aaactacacg atgccattga gaggacctct gataattatg gcgcaacaag gacaagtaac
     1621 gtcaagaaac cgttgacaaa caagagaaag gcttctgata cggacaagat tggagccgta
     1681 aatagcagag gtcgattgaa agattcctta acagataata taactgtgaa cattacaaac
     1741 aaggatgtgt tgattgtcgt gacttgttct tccaaggagt ttgtattgct tgaagtgatg
     1801 gaagccgtaa gacgactaag tttggattcc gaaactgttc aatcttccaa cagagatgga
     1861 atgatatcta ttaccataaa agccaagtgc aagggattga aggttgcatc agcaagtgtg
     1921 atcaaacaag ctcttcagaa agttactatg aagtcttgaa gttgatttat gctcactatc
     1981 tatagctagc ttttgtgtaa aaaatttgta ttcataactt ttgctaagta atttgcaggg
     2041 cttttccaag tagttcagat caataaaaaa aaaaa
//