LOCUS       HUMHEXKIN               3580 bp    mRNA    linear   HUM 27-FEB-2002
DEFINITION  Homo sapiens hexokinase 1 (HK1) mRNA, complete cds.
ACCESSION   M75126 X61091
VERSION     M75126.1
KEYWORDS    hexokinase 1.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3580)
  AUTHORS   Nishi,S., Seino,S. and Bell,G.I.
  TITLE     Human hexokinase: sequences of amino- and carboxyl-terminal halves
            are homologous
  JOURNAL   Biochem. Biophys. Res. Commun. 157 (3), 937-943 (1988)
   PUBMED   3207429
COMMENT     On Feb 26, 2002 this sequence version replaced gi:32118.
FEATURES             Location/Qualifiers
     source          1..3580
                     /db_xref="H-InvDB:HIT000196350"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="kidney"
                     /dev_stage="adult"
     gene            1..3580
                     /gene="HK1"
     5'UTR           1..81
                     /gene="HK1"
     CDS             82..2835
                     /gene="HK1"
                     /codon_start=1
                     /product="hexokinase 1"
                     /protein_id="AAA52646.1"
                     /db_xref="GI:184021"
                     /db_xref="GDB:G00-120-044"
                     /translation="MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFR
                     KEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKN
                     QNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQ
                     SKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCG
                     YDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTE
                     FDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKF
                     NTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGA
                     ILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSG
                     KGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAV
                     VKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEI
                     MQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFK
                     ATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGS
                     NACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVNEYSLNAGKQR
                     YEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETMKTRGIFETKFLSQIESDRLALL
                     QVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNV
                     TVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTE
                     ASS"
     3'UTR           2836..3580
                     /gene="HK1"
BASE COUNT          867 a          905 c         1030 g          778 t
ORIGIN      
        1 ccgccggagg accacggctc gccagggctg cggaggaccg accgtcccca cgcctgccgc
       61 cccgcgaccc cgaccgccag catgatcgcc gcgcagctcc tggcctatta cttcacggag
      121 ctgaaggatg accaggtcaa aaagattgac aagtatctgt atgccatgcg gctctccgat
      181 gaaactctca tagatatcat gactcgcttc aggaaggaga tgaagaatgg cctctcccgg
      241 gattttaatc caacagccac agtcaagatg ttgccaacat tcgtaaggtc cattcctgat
      301 ggctctgaaa agggagattt cattgccctg gatcttggtg ggtcttcctt tcgaattctg
      361 cgggtgcaag tgaatcatga gaaaaaccag aatgttcaca tggagtccga ggtttatgac
      421 accccagaga acatcgtgca cggcagtgga agccagcttt ttgatcatgt tgctgagtgc
      481 ctgggagatt tcatggagaa aaggaagatc aaggacaaga agttacctgt gggattcacg
      541 ttttcttttc cttgccaaca atccaaaata gatgaggcca tcctgatcac ctggacaaag
      601 cgatttaaag cgagcggagt ggaaggagca gatgtggtca aactgcttaa caaagccatc
      661 aaaaagcgag gggactatga tgccaacatc gtagctgtgg tgaatgacac agtgggcacc
      721 atgatgacct gtggctatga cgaccagcac tgtgaagtcg gcctgatcat cggcactggc
      781 accaatgctt gctacatgga ggaactgagg cacattgatc tggtggaagg agacgagggg
      841 aggatgtgta tcaatacaga atggggagcc tttggagacg atggatcatt agaagacatc
      901 cggacagagt ttgacaggga gatagaccgg ggatccctca accctggaaa acagctgttt
      961 gagaagatgg tcagtggcat gtacttggga gagctggttc gactgatcct agtcaagatg
     1021 gccaaggagg gcctcttatt tgaagggcgg atcaccccgg agctgctcac ccgagggaag
     1081 tttaacacca gtgatgtgtc agccatcgaa aagaataagg aaggcctcca caatgccaaa
     1141 gaaatcctga cccgcctggg agtggagccg tccgatgatg actgtgtctc agtccagcac
     1201 gtttgcacca ttgtctcatt tcgctcagcc aacttggtgg ctgccacact gggcgccatc
     1261 ttgaaccgcc tgcgtgataa caagggcaca cccaggctgc ggaccacggt tggtgtcgac
     1321 ggatctcttt acaagacgca cccacagtat tcccggcgtt tccacaagac tctaaggcgc
     1381 ttggtgccag actccgatgt gcgcttcctc ctctcggaga gtggcagcgg caagggggct
     1441 gccatggtga cggcggtggc ctaccgcttg gccgagcagc accggcagat agaggagacc
     1501 ctggctcatt tccacctcac caaagacatg ctgctggagg tgaagaagag gatgcgggcc
     1561 gagatggagc tggggctgag gaagcagacg cacaacaatg ccgtggttaa gatgctgccc
     1621 tccttcgtcc ggagaactcc cgacgggacc gagaatggtg acttcttggc cctggatctt
     1681 ggaggaacca atttccgtgt gctgctggtg aaaatccgta gtgggaaaaa gagaacggtg
     1741 gaaatgcaca acaagatcta cgccattcct attgaaatca tgcagggcac tggggaagag
     1801 ctgtttgatc acattgtctc ctgcatctct gacttcttgg actacatggg gatcaaaggc
     1861 cccaggatgc ctctgggctt cacgttctca tttccctgcc agcagacgag tctggacgcg
     1921 ggaatcttga tcacgtggac aaagggtttt aaggcaacag actgcgtggg ccacgatgta
     1981 gtcaccttac taagggatgc gataaaaagg agagaggaat ttgacctgga cgtggtggct
     2041 gtggtcaacg acacagtggg caccatgatg acctgtgctt atgaggagcc cacctgtgag
     2101 gttggactca ttgttgggac cggcagcaat gcctgctaca tggaggagat gaagaacgtg
     2161 gagatggtgg agggggacca ggggcagatg tgcatcaaca tggagtgggg ggcctttggg
     2221 gacaacgggt gtctggatga tatcaggaca cactacgaca gactggtgaa cgaatattcc
     2281 ctaaatgctg ggaaacaaag gtatgagaag atgatcagtg gtatgtacct gggtgaaatc
     2341 gtccgcaaca tcttaatcga cttcaccaag aagggattcc tcttccgagg gcagatctct
     2401 gagacgatga agacccgggg catctttgag accaagtttc tctctcagat cgagagtgac
     2461 cgattagcac tgctccaggt ccgggctatc ctccagcagc taggtctgaa tagcacctgc
     2521 gatgacagta tcctcgtcaa gacagtgtgc ggggtggtgt ccaggagggc cgcacagctg
     2581 tgtggcgcag gcatggctgc ggttgtggat aagatccgcg agaacagagg actggaccgt
     2641 ctgaatgtga ctgtgggagt ggacgggaca ctctacaagc ttcatccaca cttctccaga
     2701 atcatgcacc agacggtgaa ggaactgtca ccaaaatgta acgtgtcctt cctcctgtct
     2761 gaggatggca gcggcaaggg ggccgccctc atcacggccg tgggcgtgcg gttacgcaca
     2821 gaggcaagca gctaagagtc cgggatcccc agcctactgc ctctccagca cttctctctt
     2881 caagcggcga ccccctaccc tcccagcgag ttgcgctggg agacgctggc gccagggcct
     2941 gccggcgcgg ggaggaaagc aaaatccaac taatggtata tattgtaggg tacagaatag
     3001 agcgtgtgct gttgataata tctctcaccc ggatccctcc tcacttgccc tgccactttg
     3061 catggtttga ttttgacctg gtcccccacg tgtgaagtgt agtggcatcc atttctaatg
     3121 tatgcattca tccaacagag ttatttattg gctggagatg gaaaatcaca ccacctgaca
     3181 ggccttctgg gcctccaaag cccatccttg gggttccccc tccctgtgtg aaatgtatta
     3241 tcaccagcag acactgccgg gcctccctcc cgggggcact gcctgaaggc gagtgtgggc
     3301 atagcattag ctgcttcctc ccctcctggc acccactgtg gcctggcatc gcatcgtggt
     3361 gtgtcaatgc cacaaaatcg tgtgtccgtg gaaccagtcc tagccgcgtg tgacagtctt
     3421 gcattctgtt tgtctcgtgg ggggaggtgg acagtcctgc ggaaatgtgt cttgtcttcc
     3481 atttggataa aaggaaccaa ccaacaaaca atgccatcac tggaatttcc caccgctttg
     3541 tgagccgtgt cgtatgacct agtaaacttt gtaccaattc
//