LOCUS       HUMRACPC                2610 bp    mRNA    linear   HUM 27-APR-1993
DEFINITION  Human rac protein kinase alpha mRNA, complete cds.
ACCESSION   M63167
VERSION     M63167.1
KEYWORDS    rac protein kinase-alpha; serine/threonine kinase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2610)
  AUTHORS   Jones,P.F., Jakubowicz,T., Pitossi,F.J., Maurer,F. and
            Hemmings,B.A.
  TITLE     Molecular cloning and identification of a serine/threonine protein
            kinase of the second-messenger subfamily
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88 (10), 4171-4175 (1991)
   PUBMED   1851997
COMMENT     Original source text: Human, cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..2610
                     /db_xref="H-InvDB:HIT000196062"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             199..1641
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="rac protein kinase-alpha"
                     /protein_id="AAA36539.1"
                     /db_xref="GI:190828"
                     /translation="MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQD
                     VDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTA
                     IQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGT
                     FGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQ
                     THDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLK
                     LENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWG
                     LGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRL
                     GGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIT
                     PPDQDDSMECVDSERRPHFPQFSYSASSTA"
BASE COUNT          537 a          752 c          781 g          540 t
ORIGIN      
        1 atcctgggac agggcacagg gccatctgtc accaggggct tagggaaggc cgagccagcc
       61 tgggtcaaag aagtcaaagg ggctgcctgg aggaggcagc ctgtcagctg gtgcatcaga
      121 ggctgtggcc aggccagctg ggctcgggga gcgccagcct gagaggagcg cgtgagcgtc
      181 gcgggagcct cgggcaccat gagcgacgtg gctattgtga aggagggttg gctgcacaaa
      241 cgaggggagt acatcaagac ctggcggcca cgctacttcc tcctcaagaa tgatggcacc
      301 ttcattggct acaaggagcg gccgcaggat gtggaccaac gtgaggctcc cctcaacaac
      361 ttctctgtgg cgcagtgcca gctgatgaag acggagcggc cccggcccaa caccttcatc
      421 atccgctgcc tgcagtggac cactgtcatc gaacgcacct tccatgtgga gactcctgag
      481 gagcgggagg agtggacaac cgccatccag actgtggctg acggcctcaa gaagcaggag
      541 gaggaggaga tggacttccg gtcgggctca cccagtgaca actcaggggc tgaagagatg
      601 gaggtgtccc tggccaagcc caagcaccgc gtgaccatga acgagtttga gtacctgaag
      661 ctgctgggca agggcacttt cggcaaggtg atcctggtga aggagaaggc cacaggccgc
      721 tactacgcca tgaagatcct caagaaggaa gtcatcgtgg ccaaggacga ggtggcccac
      781 acactcaccg agaaccgcgt cctgcagaac tccaggcacc ccttcctcac agccctgaag
      841 tactctttcc agacccacga ccgcctctgc tttgtcatgg agtacgccaa cgggggcgag
      901 ctgttcttcc acctgtcccg ggaacgtgtg ttctccgagg accgggcccg cttctatggc
      961 gctgagattg tgtcagccct ggactacctg cactcggaga agaacgtggt gtaccgggac
     1021 ctcaagctgg agaacctcat gctggacaag gacgggcaca ttaagatcac agacttcggg
     1081 ctgtgcaagg aggggatcaa ggacggtgcc accatgaaga ccttttgcgg cacacctgag
     1141 tacctggccc ccgaggtgct ggaggacaat gactacggcc gtgcagtgga ctggtggggg
     1201 ctgggcgtgg tcatgtacga gatgatgtgc ggtcgcctgc ccttctacaa ccaggaccat
     1261 gagaagcttt ttgagctcat cctcatggag gagatccgct tcccgcgcac gcttggtccc
     1321 gaggccaagt ccttgctttc agggctgctc aagaaggacc ccaagcagag gcttggcggg
     1381 ggctccgagg acgccaagga gatcatgcag catcgcttct ttgccggtat cgtgtggcag
     1441 cacgtgtacg agaagaagct cagcccaccc ttcaagcccc aggtcacgtc ggagactgac
     1501 accaggtatt ttgatgagga gttcacggcc cagatgatca ccatcacacc acctgaccaa
     1561 gatgacagca tggagtgtgt ggacagcgag cgcaggcccc acttccccca gttctcctac
     1621 tcggccagca gcacggcctg aggcggcggt ggactgcgct ggacgatagc ttggagggat
     1681 ggagaggcgg cctcgtgcca tgatctgtat ttaatggttt ttatttctcg ggtgcatttg
     1741 agagaagcca cgctgtcctc tcgagcccag atggaaagac gtttttgtgc tgtgggcagc
     1801 accctccccc gcagcggggt agggaagaaa actatcctgc gggttttaat ttatttcatc
     1861 cagtttgttc tccgggtgtg gcctcagccc tcagaacaat ccgattcacg tagggaaatg
     1921 ttaaggactt ctacagctat gcgcaatgtg gcattggggg gccgggcagg tcctgcccat
     1981 gtgtcccctc actctgtcag ccagccgccc tgggctgtct gtcaccagct atctgtcatc
     2041 tctctggggc cctgggcctc agttcaacct ggtggcacca gatgcaacct cactatggta
     2101 tgctggccag caccctctcc tgggggtggc aggcacacag cagcccccca gcactaaggc
     2161 cgtgtctctg aggacgtcat cggaggctgg gcccctggga tgggaccagg gatgggggat
     2221 gggccagggt ttacccagtg ggacagagga gcaaggttta aatttgttat tgtgtattat
     2281 gttgttcaaa tgcattttgg gggtttttaa tctttgtgac aggaaagccc tcccccttcc
     2341 ccttctgtgt cacagttctt ggtgactgtc ccaccggagc ctccccctca gatgatctct
     2401 ccacggtagc acttgacctt ttcgacgctt aacctttccg ctgtcgcccc aggccctccc
     2461 tgactccctg tgggggtggc catccctggg cccctccacg cctcctggcc agacgctgcc
     2521 gctgccgctg caccacggcg tttttttaca acattcaact ttagtatttt tactattata
     2581 atataatatg gaaccttccc tccaaattct
//