LOCUS       HUMNFKB                 3625 bp    mRNA    linear   HUM 27-APR-1993
DEFINITION  Human nuclear factor kappa-B DNA binding subunit (NF-kappa-B) mRNA,
            complete cds.
ACCESSION   M58603
VERSION     M58603.1
KEYWORDS    nuclear factor kappa-B DNA binding subunit.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3625)
  AUTHORS   Meyer,R., Hatada,E.N., Hohmann,H.P., Haiker,M., Bartsch,C.,
            Rothlisberger,U., Lahm,H.W., Schlaeger,E.J., van Loon,A.P. and
            Scheidereit,C.
  TITLE     Cloning of the DNA-binding subunit of human nuclear factor kappa B:
            the level of its mRNA is strongly regulated by phorbol ester or
            tumor necrosis factor alpha
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88 (3), 966-970 (1991)
   PUBMED   1992489
COMMENT     Original source text: Human premyeloid, cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..3625
                     /db_xref="H-InvDB:HIT000195882"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HL60"
                     /tissue_type="premyeloid"
                     /tissue_lib="lambda ZAP"
     CDS             398..3304
                     /codon_start=1
                     /product="nuclear factor kappa-B DNA binding subunit"
                     /protein_id="AAA36360.1"
                     /db_xref="GI:189178"
                     /translation="MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYL
                     QILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTN
                     GKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEA
                     CIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTA
                     FLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQ
                     KDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLR
                     RKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGG
                     GGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSD
                     DKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQL
                     AKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVT
                     SGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAK
                     EGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQ
                     KSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKA
                     AGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFT
                     SDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSK
                     TLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQ
                     IDELRDSDSVCDTGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI"
BASE COUNT          933 a          937 c          956 g          799 t
ORIGIN      
        1 ggccaccgga gcggcccggc gacgatcgct gacagcttcc cctgcccttc ccgtcggtcg
       61 ggccgccagc cgccgcagcc ctcggcctgc acgcagccac cggccccgct cccggagccc
      121 agcgccgccg aggccgcagc cgcccggcca gtaaggcggc gccgcccgcg gccaccgcgg
      181 gccctgccgt tccctccgcc gcgctgcgcc atggcgcggc gctgactggc ctggcccggc
      241 cccgccgcgc tcccgctcgc cccgacccgc actcgggccc gcccgggctc cggcctgccg
      301 ccgcctcttc cttctccagc cggcaggccc cgccgcttag gagggagagc ccacccgcgc
      361 caggaggccg aacgcggact cgccacccgg cttcagaatg gcagaagatg atccatattt
      421 gggaaggcct gaacaaatgt ttcatttgga tccttctttg actcatacaa tatttaatcc
      481 agaagtattt caaccacaga tggcactgcc aacagatggc ccataccttc aaatattaga
      541 gcaacctaaa cagagaggat ttcgtttccg ttatgtatgt gaaggcccat cccatggtgg
      601 actacctggt gcctctagtg aaaagaacaa gaagtcttac cctcaggtca aaatctgcaa
      661 ctatgtggga ccagcaaagg ttattgttca gttggtcaca aatggaaaaa atatccacct
      721 gcatgcccac agcctggtgg gaaaacactg tgaggatggg atctgcactg taactgctgg
      781 acccaaggac atggtggtcg gcttcgcaaa cctgggtata cttcatgtga caaagaaaaa
      841 agtatttgaa acactggaag cacgaatgac agaggcgtgt ataaggggct ataatcctgg
      901 actcttggtg caccctgacc ttgcctattt gcaagcagaa ggtggagggg accggcagct
      961 gggagatcgg gaaaaagagc taatccgcca agcagctctg cagcagacca aggagatgga
     1021 cctcagcgtg gtgcggctca tgtttacagc ttttcttccg gatagcactg gcagcttcac
     1081 aaggcgcctg gaacccgtgg tatcagacgc catctatgac agtaaagccc ccaatgcatc
     1141 caacttgaaa attgtaagaa tggacaggac agctggatgt gtgactggag gggaggaaat
     1201 ttatcttctt tgtgacaaag ttcagaaaga tgacatccag attcgatttt atgaagagga
     1261 agaaaatggt ggagtctggg aaggatttgg agatttttcc cccacagatg ttcatagaca
     1321 atttgccatt gtcttcaaaa ctccaaagta taaagatatt aatattacaa aaccagcctc
     1381 tgtgtttgtc cagcttcgga ggaaatctga cttggaaact agtgaaccaa aacctttcct
     1441 ctactatcct gaaatcaaag ataaagaaga agtgcagagg aaacgtcaga agctcatgcc
     1501 caatttttcg gatagtttcg gcggtggtag tggtgccgga gctggaggcg gaggcatgtt
     1561 tggtagtggc ggtggaggag ggggcactgg aagtacaggt ccagggtata gcttcccaca
     1621 ctatggattt cctacttatg gtgggattac tttccatcct ggaactacta aatctaatgc
     1681 tgggatgaag catggaacca tggacactga atctaaaaag gaccctgaag gttgtgacaa
     1741 aagtgatgac aaaaacactg taaacctctt tgggaaagtt attgaaacca cagagcaaga
     1801 tcaggagccc agcgaggcca ccgttgggaa tggtgaggtc actctaacgt atgcaacagg
     1861 aacaaaagaa gagagtgctg gagttcagga taacctcttt ctagagaagg ctatgcagct
     1921 tgcaaagagg catgccaatg cccttttcga ctacgcggtg acaggagacg tgaagatgct
     1981 gctggccgtc cagcgccatc tcactgctgt gcaggatgag aatggggaca gtgtcttaca
     2041 cttagcaatc atccaccttc attctcaact tgtgagggat ctactagaag tcacatctgg
     2101 tttgatttct gatgacatta tcaacatgag aaatgatctg taccagacgc ccttgcactt
     2161 ggcagtgatc actaagcagg aagatgtggt ggaggatttg ctgagggctg gggccgacct
     2221 gagccttctg gaccgcttgg gtaactctgt tttgcaccta gctgccaaag aaggacatga
     2281 taaagttctc agtatcttac tcaagcacaa aaaggcagca ctacttcttg accaccccaa
     2341 cggggacggt ctgaatgcca ttcatctagc catgatgagc aatagcctgc catgtttgct
     2401 gctgctggtg gccgctgggg ctgacgtcaa tgctcaggag cagaagtccg ggcgcacagc
     2461 actgcacctg gctgtggagc acgacaacat ctcattggca ggctgcctgc tcctggaggg
     2521 tgatgcccat gtggacagta ctacctacga tggaaccaca cccctgcata tagcagctgg
     2581 gagagggtcc accaggctgg cagctcttct caaagcagca ggagcagatc ccctggtgga
     2641 gaactttgag cctctctatg acctggatga ctcttgggaa aatgcaggag aggatgaagg
     2701 agttgtgcct ggaaccacgc ctctagatat ggccaccagc tggcaggtat ttgacatatt
     2761 aaatgggaaa ccatatgagc cagagtttac atctgatgat ttactagcac aaggagacat
     2821 gaaacagctg gctgaagatg tgaagctgca gctgtataag ttactagaaa ttcctgatcc
     2881 agacaaaaac tgggctactc tggcgcagaa attaggtctg gggatactta ataatgcctt
     2941 ccggctgagt cctgctcctt ccaaaacact tatggacaac tatgaggtct ctgggggtac
     3001 agtcagagag ctggtggagg ccctgagaca aatgggctac accgaagcaa ttgaagtgat
     3061 ccaggcagcc tccagcccag tgaagaccac ctctcaggcc cactcgctgc ctctctcgcc
     3121 tgcctccaca aggcagcaaa tagacgagct ccgagacagt gacagtgtct gcgacacggg
     3181 cgtggagaca tccttccgca aactcagctt taccgagtct ctgaccagtg gtgcctcact
     3241 gctaactctc aacaaaatgc cccatgatta tgggcaggaa ggacctctag aaggcaaaat
     3301 ttagcctgct gacaatttcc cacaccgtgt aaaccaaagc cctaaaattc cactgcgttg
     3361 tccacaagac agaagctgaa gtgcatccaa aggtgctcag agagccggcc cgcctgaatc
     3421 attctcgatt taactcgaga ccttttcaac ttggcttcct ttcttggttc ataaatgaat
     3481 tttagtttgg ttcacttaca gatagtatct agcaatcaca acactggctg agcggatgca
     3541 tctggggatg aggttgctta ctaagctttg ccagctgctg ctggatcaca gctgctttct
     3601 gttgtcattg ctgttgtccc tctgc
//